Property Summary

NCBI Gene PubMed Count 54
PubMed Score 130.25
PubTator Score 52.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.600 4.9e-06
osteosarcoma 3.309 9.3e-07
sonic hedgehog group medulloblastoma 2.300 4.2e-08
glioblastoma 1.600 1.3e-02
primitive neuroectodermal tumor 1.700 4.7e-02
ulcerative colitis -1.186 2.2e-02
juvenile dermatomyositis 1.265 9.7e-10
Amyotrophic Lateral Sclerosis 1.094 2.9e-06
primary pancreatic ductal adenocarcinoma 2.297 7.5e-05
breast carcinoma -1.400 2.2e-27
atypical teratoid/rhabdoid tumor 1.100 1.9e-02
subependymal giant cell astrocytoma 4.137 6.1e-03
lung adenocarcinoma -1.200 7.3e-06
invasive ductal carcinoma -1.148 1.4e-03
Breast cancer -2.100 1.7e-08
lung carcinoma -2.100 2.6e-13
spina bifida -1.738 3.6e-02
gastric carcinoma 1.200 3.8e-02
ovarian cancer 2.000 2.4e-04
pituitary cancer 1.100 3.7e-02
pancreatic cancer 2.000 2.5e-04

Gene RIF (43)

PMID Text
26976596 RhoA-ROCK-Rnd3 feedback loop determined the local reassembly sites of the actin cortex during membrane blebbing.
26132659 the development and application of a novel data integration methodology reveals novel functions of RND3 in controlling glioma cell migration, invasion, proliferation, angiogenesis and clinical outcome.
26108681 We conclude that downregulation of RND3 is responsible for the enhancement of Notch activity that promotes glioblastoma genesis.
25372032 Rnd3 regulates lung cancer cell proliferation through notch signaling.
24667864 MicroRNA-200b acts as a stimulant for the proliferation of HTFs by targeting p27/kip1 and RND3.
24525741 define RhoE as a Notch1 target that is essential for recruitment of N1IC to promoters of Notch1 target genes, establishing a regulatory feedback loop in Notch1 signaling
24399089 RhoE may participate in human cancer progression and act as a candidate target of p53, and these findings also strongly suggest that RhoE may be a new candidate tumor suppressor and could serve as a potential target in the gene therapy of cancer.
24312338 CXCR4 might be a downstream effector for RhoE
24045951 a mechanism according to which proteasomal degradation of RhoE by Skp2 regulates its protein levels to control cellular proliferation.
23821457 Transfection of pre-miR-200c reduces RhoE expression.
23630292 Rnd3 is a regulator of Notch1 signaling
23622247 Study reports a high-affinity 14-3-3-binding site at the C terminus of Rnd3 consisting of both the Cys241-farnesyl moiety and a Rho-associated coiled coil containing protein kinase (ROCK)-dependent Ser240 phosphorylation site.
23546594 alteration of the malignant behavior of cancer cells by AES is related to RND3 regulation.
23333304 HIV-1 Vif modulates the expression of Rho family GTPase 3 (RND3) in Vif-expression T cells
22829315 frequently down-regulated in predominantly HBV-associated hepatocellular carcinomas
22477709 RhoE may play a driving role in the development and progression of ESCC, and targeting the RhoE may be an effective and feasible approach for treatment of ESCC.
22454524 Loss of Rnd3 expression in keratinocytes results in altered colony morphology.
22357615 role of the N-terminal region in signaling; Rnd1 and Rnd3 have a KERRA (Lys-Glu-Arg-Arg-Ala) sequence of amino acids in their N-terminus, which functions as the lipid raft-targeting determinant; the sequence mediates lipid raft targeting of p190 RhoGAP correlated with its activation
22272352 Results show that induction of RhoE by cAMP is mediated through protein kinase A (PKA) and promotes BeWo cell fusion but has no effect on functional differentiation.
22251971 The authors show that enteropathogenic Escherichia coli translocates EspH, which inactivates mammalian RhoGEFs and triggers cytotoxicity.
22234932 Rnd3 expression was significantly lower in invasive tumors with satellite nodules
22213123 expression of RhoE was significantly negatively associated with serum AFP (P = 0.013) and tumor grade (P = 0.016)
22132820 the expression of miR-17 was negatively correlated with that of RND3 in colorectal cancer tissues and cells
22037464 This study identifies RhoE as a direct target for HIF-1 in gastric cancer cells.
21917148 Restoration of RND3 expression or RHOA knockdown attenuated the migratory ability of residual cells without affecting overall cell survival
21478267 Upregulation of FOXD3 expression following inhibition of B-RAF and MEK correlates with the downregulation of Rnd3, a Rho GTPase and inhibitor of RhoA-ROCK signaling.
21209796 Data show that the increased invasiveness of tumorigenic cells was associated with reduced expression of Rnd3.
21109974 RhoE expression in gastric cancer cells was regulated by histone deacetylation, but not by DNA methylation, at the epigenetic level.
20683643 study demonstrates a novel role for mir-200b in cell cycle progression and identifies RND3 as a novel mir-200b target
19850923 RhoE inhibits 4E-BP1 phosphorylation and eIF4E function impairing cap-dependent translation.
19244113 Findings implicate Rnd3 as a major suppressor of RhoA-mediated actin cytoskeletal organization and in the acquisition of an invasive melanoma phenotype.
19101510 This study demonstrated that RhoE may promote the multidrug resistance phenotype of gastric cancer cells by decreasing the expression of Bax at posttranscriptional level, thus inhibiting vincristine-induced apoptosis.
18946488 mutation of the RhoE effector region attenuates RhoE-mediated disruption of the actin cytoskeleton, indicating that RhoE exerts its inhibitory effects on ROCK-I through protein(s) binding to its effector region.
18923151 Data show that RhoE integrates two processes essential for keratinocyte differentiation and stratification: regulation of proliferative status and integrin adhesion.
18721871 Staphylococcal enterotoxin B-treated renal proximal tubule epithelial cells, show 32 differentially expressed transcripts; one of the down-regulated DETs matched the sequence for Rnd3, which normally inhibits Rho protein function.
18204440 PDK1 competes directly with RhoE for binding to ROCK1. In the absence of PDK1, negative regulation by RhoE predominates, causing reduced acto-myosin contractility and motility.
18045987 These results identify Rnd3 as a regulator of cross talk between the RAF/MEK/ERK and Rho/ROCK signaling pathways, and a key contributor to oncogene-mediated reorganization of the actin cytoskeleton and focal adhesions.
17182035 RhoE plays an important role in the regulation of cell proliferation and survival and may be considered as an oncosupressor since it is capable to induce apoptosis in several tumor cell lines.
17174923 Study demonstrates that the p53-mediated induction of RhoE in response to DNA damage favors cell survival partly through inhibition of ROCK I-mediated apoptosis.
16311049 The RND3 mRNA levels increased significantly after gestation in myometria.
15777789 Rnd3/RhoE regulates the assembly of the apical junction complex and tight junction sealing when transfected to a rat tumor cell line.
15754346 RhoE is a tumor suppressor gene that is downregulated early in the development of prostate cancer
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence

MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQR      1 - 70
IELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLR     71 - 140
TDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKS    141 - 210
QRATKRISHMPSRPELSAVATDLRKDKAKSCTVM                                        211 - 244
//

Text Mined References (54)

PMID Year Title
26976596 2016 A RhoA and Rnd3 cycle regulates actin reassembly during membrane blebbing.
26132659 2015 Inference of Low and High-Grade Glioma Gene Regulatory Networks Delineates the Role of Rnd3 in Establishing Multiple Hallmarks of Cancer.
26108681 2015 Downregulation of RND3/RhoE in glioblastoma patients promotes tumorigenesis through augmentation of notch transcriptional complex activity.
25372032 2014 Rnd3 regulates lung cancer cell proliferation through notch signaling.
24667864 2014 TGF-?1 stimulates human Tenon's capsule fibroblast proliferation by miR-200b and its targeting of p27/kip1 and RND3.
24525741 2014 Small GTPase RhoE/Rnd3 is a critical regulator of Notch1 signaling.
24399089 2014 The Rho GTPase RhoE is a p53-regulated candidate tumor suppressor in cancer cells.
24312338 2013 RhoE promotes metastasis in gastric cancer through a mechanism dependent on enhanced expression of CXCR4.
24045951 2013 The Rho family member RhoE interacts with Skp2 and is degraded at the proteasome during cell cycle progression.
23821457 2014 MicroRNA-200c regulates the sensitivity of chemotherapy of gastric cancer SGC7901/DDP cells by directly targeting RhoE.
23630292 2013 Genetic deletion of Rnd3 results in aqueductal stenosis leading to hydrocephalus through up-regulation of Notch signaling.
23622247 2013 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins.
23546594 2013 Suppression of RND3 activity by AES downregulation promotes cancer cell proliferation and invasion.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22829315 2013 RhoE is frequently down-regulated in hepatocellular carcinoma (HCC) and suppresses HCC invasion through antagonizing the Rho/Rho-kinase/myosin phosphatase target pathway.
22477709 2012 RhoE functions as a tumor suppressor in esophageal squamous cell carcinoma and modulates the PTEN/PI3K/Akt signaling pathway.
22454524 2012 Plakoglobin-dependent regulation of keratinocyte apoptosis by Rnd3.
22357615 2012 Rnd1 and Rnd3 targeting to lipid raft is required for p190 RhoGAP activation.
22272352 2012 RhoE is regulated by cyclic AMP and promotes fusion of human BeWo choriocarcinoma cells.
22251971 2012 The interplay between the Escherichia coli Rho guanine nucleotide exchange factor effectors and the mammalian RhoGEF inhibitor EspH.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
22234932 2012 Rnd3/RhoE Is down-regulated in hepatocellular carcinoma and controls cellular invasion.
22213123 2012 Down-regulation of RhoE is associated with progression and poor prognosis in hepatocellular carcinoma.
22132820 2012 Up-regulated miR-17 promotes cell proliferation, tumour growth and cell cycle progression by targeting the RND3 tumour suppressor gene in colorectal carcinoma.
22037464 2011 Transcriptional up-regulation of RhoE by hypoxia-inducible factor (HIF)-1 promotes epithelial to mesenchymal transition of gastric cancer cells during hypoxia.
21917148 2011 A switch in RND3-RHOA signaling is critical for melanoma cell invasion following mutant-BRAF inhibition.
21478267 2011 FOXD3 regulates migration properties and Rnd3 expression in melanoma cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21209796 2010 Reduced expression of the ROCK inhibitor Rnd3 is associated with increased invasiveness and metastatic potential in mesenchymal tumor cells.
21109974 2011 Epigenetic modification of RhoE expression in gastric cancer cells.
20683643 2010 MicroRNA-200b regulates cyclin D1 expression and promotes S-phase entry by targeting RND3 in HeLa cells.
19850923 2009 RhoE inhibits 4E-BP1 phosphorylation and eIF4E function impairing cap-dependent translation.
19244113 2009 Rnd3 regulation of the actin cytoskeleton promotes melanoma migration and invasive outgrowth in three dimensions.
19101510 2009 RhoE enhances multidrug resistance of gastric cancer cells by suppressing Bax.
18946488 2008 Mechanism of multi-site phosphorylation from a ROCK-I:RhoE complex structure.
18923151 2009 RhoE Is required for keratinocyte differentiation and stratification.
18721871 Staphylococcal enterotoxin B causes differential expression of Rnd3 and RhoA in renal proximal tubule epithelial cells while inducing actin stress fiber assembly and apoptosis.
18204440 2008 PDK1 regulates cancer cell motility by antagonising inhibition of ROCK1 by RhoE.
18045987 2008 B-RAF regulation of Rnd3 participates in actin cytoskeletal and focal adhesion organization.
17182035 2007 RhoE interferes with Rb inactivation and regulates the proliferation and survival of the U87 human glioblastoma cell line.
17174923 2006 RhoE is a pro-survival p53 target gene that inhibits ROCK I-mediated apoptosis in response to genotoxic stress.
16311049 2005 Differences in the gestational pattern of mRNA expression of the Rnd family in rat and human myometria.
15777789 2005 Rnd3/RhoE induces tight junction formation in mammary epithelial tumor cells.
15754346 2005 Small G-protein RhoE is underexpressed in prostate cancer and induces cell cycle arrest and apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12842009 2003 Rnd proteins function as RhoA antagonists by activating p190 RhoGAP.
12773565 2003 RhoE binds to ROCK I and inhibits downstream signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163169 2002 Crystal structure of Rnd3/RhoE: functional implications.
11940653 2002 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers.
9531558 1998 A new member of the Rho family, Rnd1, promotes disassembly of actin filament structures and loss of cell adhesion.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8649376 1996 Identification of a novel human Rho protein with unusual properties: GTPase deficiency and in vivo farnesylation.