1. Home
  2. Targets
  3. enzyme modulator
  4. G-protein
  5. small GTPase
  6. Rho-related GTP-binding protein Rho6

Tbio Rho-related GTP-binding protein Rho6

Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filaments. Causes the formation of many neuritic processes from the cell body with disruption of the cortical actin filaments.

This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension. [provided by RefSeq, Apr 2014]

 Comments

Property Summary

NCBI Gene PubMed Count 24
PubMed Score 116.33
PubTator Score 27.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 7.3e-03
ependymoma -2.100 7.5e-03
oligodendroglioma -1.100 3.4e-02
psoriasis 3.900 1.5e-178
glioblastoma -2.100 7.5e-04
sonic hedgehog group medulloblastoma -2.800 7.6e-06
atypical teratoid / rhabdoid tumor -2.600 5.1e-08
medulloblastoma, large-cell -3.300 1.9e-05
primitive neuroectodermal tumor -1.700 2.0e-03
non-small cell lung cancer -1.854 3.0e-08
lung cancer -5.800 2.5e-07
adult high grade glioma -2.200 8.5e-05
pilocytic astrocytoma -1.600 7.4e-06

Synonym

Accession Q92730 A8K9P7
Symbols ARHS
RHO6
RHOS

Gene

RND1

PANTHER Protein Class (3)

PDB

2REX   3Q3J   2CLS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (13)

See all...

 GO Function (3)

 GO Component (4)

 GO Process (4)

 Compartment GO Term (21)

See all...

 HCA RNA Cell Line (52)

See all...

Pathway (10)

Protein-protein Interaction (19)

NRP1   ARHGEF11   PLXNB1   PLXNA2   ROCK2   RHOC   MET   RRAS   RHOA   RHOB   RAC1   RHOG   ROCK1   SEMA3A   SEMA4D   PLXNA4   ARHGAP35   ARHGEF12   PLXNA1  

Gene RIF (9)

PMID Text
25531777 These results reveal a previously unappreciated mechanism through which Rnd1 restrains activation of Ras-MAPK signalling and breast tumour initiation and progression
23603360 Data indicate that Rnd1 efficiently displaces Rac1 from its complex with Plexin-B1 but not vice versa.
22357615 role of the N-terminal region in signaling; Rnd1 and Rnd3 have a KERRA (Lys-Glu-Arg-Arg-Ala) sequence of amino acids in their N-terminus, which functions as the lipid raft-targeting determinant; the sequence mediates lipid raft targeting of p190 RhoGAP correlated with its activation
21610070 Rnd1 does not play a role in the activation of plexin-C1 and -D1
18996843 SCG10 acts as an effector downstream of Rnd1 to regulate axon extensions by modulating microtubule organization.
18976975 Knockdown of Rho family GTPase 1 (RND1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17916560 Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain
16311049 The RND1 mRNA expression levels increased significantly after gestation in myometria.
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence 

MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG      1 - 70
SPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS     71 - 140
HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHL    141 - 210
PSRSELISSTFKKEKAKSCSIM                                                    211 - 232
//

Text Mined References (25)

PMID Year Title
25531777 2015 The Rho GTPase Rnd1 suppresses mammary tumorigenesis and EMT by restraining Ras-MAPK signalling.
23825416 2013 A multilevel screening strategy defines a molecular fingerprint of proregenerative olfactory ensheathing cells and identifies SCARB2, a protein that improves regenerative sprouting of injured sensory spinal axons.
23603360 2013 Interaction characteristics of Plexin-B1 with Rho family proteins.
23201090 2013 miR-199a-5p regulates urothelial permeability and may play a role in bladder pain syndrome.
22357615 2012 Rnd1 and Rnd3 targeting to lipid raft is required for p190 RhoGAP activation.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21610070 2011 Structural basis of Rnd1 binding to plexin Rho GTPase binding domains (RBDs).
19843518 2009 Structure and function of the intracellular region of the plexin-b1 transmembrane receptor.
18996843 2009 Rnd1 regulates axon extension by enhancing the microtubule destabilizing activity of SCG10.
17916560 2007 Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.
16311049 2005 Differences in the gestational pattern of mRNA expression of the Rnd family in rat and human myometria.
16188938 2005 p190 Rho-GTPase activating protein associates with plexins and it is required for semaphorin signalling.
15738000 2005 Direct interaction of Rnd1 with FRS2 beta regulates Rnd1-induced down-regulation of RhoA activity and is involved in fibroblast growth factor-induced neurite outgrowth in PC12 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14732713 2004 Identification of splicing variants of Rapostlin, a novel RND2 effector that interacts with neural Wiskott-Aldrich syndrome protein and induces neurite branching.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730235 2003 Direct interaction of Rnd1 with Plexin-B1 regulates PDZ-RhoGEF-mediated Rho activation by Plexin-B1 and induces cell contraction in COS-7 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980706 2002 The complex of Arl2-GTP and PDE delta: from structure to function.
11940653 2002 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers.
11786539 2002 The delta subunit of retinal rod cGMP phosphodiesterase regulates the membrane association of Ras and Rap GTPases.
11108845 2000 The semaphorin 3A receptor may directly regulate the activity of small GTPases.
11095956 2000 Rnd1, a novel rho family GTPase, induces the formation of neuritic processes in PC12 cells.
10664463 2000 Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family.
9531558 1998 A new member of the Rho family, Rnd1, promotes disassembly of actin filament structures and loss of cell adhesion.