Property Summary

NCBI Gene PubMed Count 126
PubMed Score 493.78
PubTator Score 397.12

Knowledge Summary

Patent (24,366)

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.100 5.3e-03
hepatocellular carcinoma 1.800 6.4e-06
pancreatic cancer 1.400 2.4e-03
osteosarcoma -1.002 3.7e-04
cystic fibrosis 1.158 5.3e-05
atypical teratoid / rhabdoid tumor -2.600 3.3e-05
medulloblastoma, large-cell -2.200 1.7e-03
juvenile dermatomyositis 1.053 1.7e-10
intraductal papillary-mucinous adenoma (... 1.500 1.3e-02
intraductal papillary-mucinous carcinoma... 1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.8e-02
lung cancer -1.300 7.4e-03
pancreatic carcinoma 1.400 2.4e-03
spina bifida -1.013 3.9e-02
ovarian cancer -3.200 3.3e-10

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (124)

PMID Text
26858407 OAS3 displayed a higher affinity for dsRNA in intact cells than either OAS1 or OAS2, consistent with its dominant role in RNase L activation.
26771888 Single Nucleotide Polymorphisms in RNASEL involved in the immune response are generally not associated with intraprostatic inflammation in men without a Prostate cancer diagnosis.
26760998 This review outlines the role of RNase-L in antimicrobial immunity and the cytoskeleton-associated innate response. [review]
26668391 Data show that RNA decay by ribonuclease L (RNase L) has an important role in homeostasis and serves as a suppressor of cell adhesion.
26656695 Tanslation of vaccinia virus A27L and B5R genes is independent of PKR activation, but their expression is dependent on the RNase L activity.
26517238 Suggest that naturally occurring mutations in the RNase L gene might promote enhanced prostate cancer cell migration and metastasis.
26263979 Our results demonstrate a novel role of RNase L generated small RNAs in cross-talk between autophagy and apoptosis that impacts the fate of cells during viral infections and cancer.
26236721 Among 794 RNASEL Ssingle nucleotide polymorphism (SNPs) entries 124 SNPs were found nonsynonymous (ns) from which SIFT predicted 13 nsSNPs as nontolerable whereas PolyPhen-2 predicted 28.
25540362 These data show that RNase L targets specific sites in both host and viral RNAs to restrict influenza virus replication when NS1 protein is disabled.
25352621 Virus infection and RNase L activation disrupt its association with Filamin A and release RNase L to mediate its canonical nuclease-dependent antiviral activities.
25301952 a model of feedback regulation in which RNase L and TTP target SRF mRNA and SRF-induced transcripts.
25286525 RNAse L gene SNP 1385G>A does not have a clear clinical significance in CHC.
25275129 The combined high affinity for double-stranded RNA and the capability to produce 2'-5'-linked oligoadenylates of sufficient length to activate RNase L suggests that OAS3 is a potent activator of RNase L.
24905202 The IFNs inhibit viral infections in part through the 2',5'-oligoadenylate (2-5A) synthetase (OAS)/RNase L pathway.
24733098 This work identifies novel roles for IFN-beta and RNase L in cell barrier functions that are targeted by bacterial effectors to escape host defense mechanisms and promote virulence.
24699816 data suggest that RNASEL, an enzyme involved in RNA turnover, is controlled by miR-146a and may be important in NMSC etiology
24651439 RNase L activity limits FFA/obesity-induced impairment of insulin response in muscle cells via TLR3 and MnSOD expression.
24578532 this study reports 2.8 and 2.1 angstrom crystal structures of human RNase L in complexes with synthetic and natural ligands and a fragment of an RNA substrate.
24224612 Association between SNPs from RNASEL and chromosome 8q24 with the risk of prostate cancer, and its aggressiveness, in a Hispanic (Chilean) population.
23382116 We show an association between RNASEL SNP rs12757998 and outcome after radiation therapy for prostate cancer
23196181 among the members of the OAS family, OAS1 p46 and OAS3 p100 mediate the RNase L-dependent antiviral activity against HCV
23113544 Data show that miR-29 acts via 4 target sites within the RNASEL 3' UTR.
23109342 RNase L induces autophagy via c-Jun N-terminal kinase and double-stranded RNA-dependent protein kinase signaling pathways.
23098452 RNASEL mutations are associated with xenotropic murine leukemia virus and its R426Q polymorphism in patients with prostate cancer
23084743 Two molecules of 2-5A at a time tether RNase L monomers via the ankyrin-repeat (ANK) domain. Each ANK domain harbors two distinct sites for 2-5A recognition that reside 50 A apart.
22925698 study found that RNase L is highly expressed in lung cancer cells with significantly decreased enzymatic activity due to an increase of RLI, a specific inhibitor of RNase L
22691533 the structural changes of human RNase L as a result of interactions with four different activators: natural 2-5 pA(4) and three tetramers with 3'-end AMP
22513284 Positive selection has operated on the RNASEL gene.
22464196 Statistically significant differences were found between controls and patients in some of the genotyped regions of the RNASEL gene
22083266 genotypes associated with the worst prognoses in prostate cancer are G/G in D541E, A/A in R462Q and A/G in I97L.
21846818 Five SNPs were validated as being significantly associated with prostate cancer mortality, one each in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes.
21685539 Ribonuclease L (RNASEL) protein was shown to be up-regulated in lopinavir-treated SiHa cells, which was confirmed by PCR and western blot. Targeted silencing of RNASEL reduced the sensitivity of SiHa cells to lopinavir.
21665181 Codon 462 polymorphisms within the RNASEL gene are not associated with an increased risk of cervical cancer.
21656378 The RNASEL 541Gln allele might be a low-penetrent risk factor for sporadic prostate cancer.
21360564 This study identified three RNASEL variants that are associated with risk for prostate cancer.
21221811 The RNASEL -1385G/A polymorphism is associated with cancer risk in African descendents.
20875083 Data show that the IQ motif-containing Ras GTPase-activating-like protein 1 (IQGAP1) can associate with RNase L, and that phosphorylation occurs on the IQGAP1, and works as a regulator in apoptosis.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20576793 Genetic variation is associated with RNASEL associated with prostate cancer.
20576793 Observational study of gene-disease association. (HuGE Navigator)
20564318 Observational study of gene-disease association. (HuGE Navigator)
20410264 These studies suggest that the expression of Xpr1 and certain genotypes of the RNASEL gene, which could restrict XMRV infection, may play important roles in defining XMRV tropisms in certain cell types.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20086112 Our findings corroborate the involvement of ELAC2, MSR1, and RNASEL in the etiology of prostate cancer even in individuals without a family history.
20086112 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19961052 No asssociation was found between the G138A polymorphism and prostate cancer in 103 Venezuelan men.
19961052 Observational study of gene-disease association. (HuGE Navigator)
19853919 2'-5'-oligoadenylate synthetase type 2 (OAS2), a dsRNA binding protein involved in the pathway that activates RNase-L, is identified as a new binding partner for NOD2.
19851509 Endoribonuclease L (RNase L) regulates the myogenic and adipogenic potential of myogenic cells
19760027 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19267370 Observational study of gene-disease association. (HuGE Navigator)
19252527 RNase L downmodulation of the RNA-binding protein, HuR, and cellular growth.
19223501 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19088502 A putative loop E motif and an H-H kissing loop interaction are key features of the group C enterovirus RNA associated with the inhibition of RNase L.
18976975 Knockdown of ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) (RNASEL) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18767027 HPC2/ELAC2 and RNASEL may play a role, however minor, in prostate cancer risk among African American men.
18767027 Observational study of gene-disease association. (HuGE Navigator)
18676870 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18575592 discovered an increased risk, a heterozygous advantage and thereby a protective effect linked to the RNASEL SNP rs3738579
18575592 Observational study of gene-disease association. (HuGE Navigator)
18566991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18436282 Our results do not support a role for RNASEL, or MSR1 mutations in advanced Asian-Indian PC.
18436282 Observational study of gene-disease association. (HuGE Navigator)
18295551 Antagonistic coevolution may have occurred between a specific host locus involved in immune defense (RNASEL) and a viral pathogen.
18289577 This prospective study suggests that prostate cancer in patients with the R462Q allelic variant of the HPC1/RNASEL gene is not associated with more aggressive clinical or pathological features in radical prostatectomy specimens.
18289577 Observational study of gene-disease association. (HuGE Navigator)
18189233 common variation in the putative prostate cancer susceptibility gene, RNASEL, or its inhibitor does not contribute significantly to prostate cancer risk in Tobago Afro-Caribbean population
18189233 Observational study of gene-disease association. (HuGE Navigator)
17908993 Observational study of gene-disease association. (HuGE Navigator)
17908993 RNASEL has a role as a predisposition gene for prostate cancer in African Americans and Hispanic Caucasians
17407163 Observational study of gene-disease association. (HuGE Navigator)
17407163 results suggest that the RNASEL Gln/Gln genotype does not play an important role in the etiology of prostate cancer in the general population
17400356 RNase L could have a role in cancer biology and evidence of a tumor suppressor function of RNase L has emerged from studies on the genetics of hereditary prostate cancer [review]
17307214 the effects of oligo A synthetase/RNase on the replication cycle of parainfluenza virus type 5
17237228 HuR-dependent regulation of RNase-L enhances its antiviral activity, demonstrating the functional significance of this regulation
17234723 Positive association between higher trans-fatty acid consumption and prostate cancer may be modified by the functional RNASEL variant R462Q.
17224235 study indicated only p53 & RNASEL genotypes had significant influence on age of onset of Lynch syndrome in an additive mode of inheritance & that effects of both variants are purely additive supporting the notion
17200614 the IFN-inducible RNase L may play an important role during stress-response through RNA-degradation and apoptosis
17150764 Report of the crystal structure of the N-terminal ankyrin repeat domain of human RNase L complexed with an activator molecule containing a 5'-phosphorylated 2',5'-linked oligoadenylate, [(pp)p(A2'p5')(n)A].
17020975 Meta-analysis of gene-disease association. (HuGE Navigator)
17020975 Compared with the genotype Asp/Asp, the Glu variant at the Asp541Glu polymorphism increases prostate cancer risk by <2-fold in Caucasians, regardless of family history of the disease.
16944274 A silent polymorphism in the RNASEL gene occurs more prevalently in high-risk Ashkenazi breast/ovarian cancer patients without a BRCA1/2 mutation.
16869093 Gene is associated with inherited prostatic cancer. [review]
16627618 Data suggest that the primary role of double-stranded RNA binding by the NS1A protein in virus-infected cells is to sequester dsRNA away from RNAse L.
16537704 Observational study of gene-disease association. (HuGE Navigator)
16537704 RNASEL genetic alterations does not support a significant role in prostate cancer predisposition in Israeli Ashkenazi Jews.
16235172 Observational study of gene-disease association. (HuGE Navigator)
16235172 single nucleotide polymorphisms (SNPs) identified in RNASEL exons in hospitalized patients with West Nile Virus infection
16234235 characterization of 2',5'-linked oligoadenylate binding determinant of human RNase L
16203993 2'-5'-linked oligoadenylate activation of RNase L produces a remarkable stimulation of transcription (>/=20-fold) for genes that suppress virus replication and prostate cancer.
16166078 androgen receptor and the interferon-activated RNase L interact with each other in a ligand-dependent manner
16156900 Hepatitis c virus polyprotein expression caused a severe cytopathological effect in human cells as a result of inhibition of protein synthesis and apoptosis induction, triggered by the activation of the IFN-induced enzymes PKR and RNase L systems.
16114055 Single nucleotide polymorphisms associated with hereditary prostate cancer.
15981205 Observational study of gene-disease association. (HuGE Navigator)
15981205 results suggest that RNASEL variants Glu265X and Arg462Gln may contribute to the tumorigenesis of sporadic and familial pancreatic cancer
15908960 Human translation termination factor eRF3/GSPT1 is an interacting partner of RNase L.
15849753 These results indicated that the ankyrin-repeat domain of RNase L constricts its structure by binding of 2-5A. This observation suggests a revised model of the 2-5A-induced activation of RNase L.
15824169 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
15714208 Observational study of gene-disease association. (HuGE Navigator)
15534086 Observational study of gene-disease association. (HuGE Navigator)
15534086 RNASEL does not have a major role in prostate cancer etiology
15330212 Observational study of gene-disease association. (HuGE Navigator)
15330212 Studies report an association between the RNASEL G1385A variant and prostate cancer risk; this variant does not appear to be implicated in the development of breast cancer.
15107989 does not constitute a major cell defence mechanism against the varicella-zoster virus infection
14695991 RNASEL may function as a tumor suppressor in prostate cancer.
14570908 JNK and RNase L function in an integrated signaling pathway during the IFN response that leads to elimination of virus-infected cells through apoptosis
12915880 Observational study of gene-disease association. (HuGE Navigator)
12915880 polymorphic changes within the RNASEL gene may be associated with familial prostate cancer risk
12653398 A genome-wide scan of high risk prostate cancer families in North America has demonstrated linkage of a particular marker to chromosme 1q(HPC1).
12624151 Observational study of gene-disease association. (HuGE Navigator)
12590567 Author reviews the tumor suppressor role of RNase L, proposing that it functions in counteracting prostate cancer by virtue of its ability to degrade RNA, thus initiating a cellular stress response that leads to apoptosis.
12415269 The variant Arg462Gln has 3X less enzymatic activity than the wildtype and is significantly associated with prostate cancer risk (P=0.007).
12145743 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12145743 A novel founder mutation in the RNASEL gene, 471delAAAG, is associated with prostate cancer in Ashkenazi Jews.
12118002 in rRNA and small nucleolar RNA maturation, not in telomere elongation inhibition
12073768 physical performance and prediction of 2-5A synthetase antiviral pathway activity in patients with chronic fatigue syndrome.
12034027 Structural and functional features of the 37-kDa 2-5A-dependent RNase L in chronic fatigue syndrome
12022038 Analysis of the RNASEL gene in familial and sporadic prostate cancer. A total of six variants were identified, including one intronic and five exonic changes (three missense and two silent alterations).
11941539 Observational study of gene-disease association. (HuGE Navigator)
11941539 Germline alterations of the RNASEL gene, a candidate HPC1 gene at 1q25, in patients and families with prostate cancer.

AA Sequence

MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMS      1 - 70
REDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKA     71 - 140
LKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHAL    141 - 210
LSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLA    211 - 280
VELKLKKIAELLCKRGASTDCGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDL    281 - 350
HRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF    351 - 420
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQN    421 - 490
ILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETK    491 - 560
DLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFD    561 - 630
KWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLV    631 - 700
IYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC                                 701 - 741
//

Text Mined References (133)

PMID Year Title
26858407 2016 Activation of RNase L is dependent on OAS3 expression during infection with diverse human viruses.
26771888 2016 Key genes involved in the immune response are generally not associated with intraprostatic inflammation in men without a prostate cancer diagnosis: Results from the prostate cancer prevention trial.
26760998 2016 The Roles of RNase-L in Antimicrobial Immunity and the Cytoskeleton-Associated Innate Response.
26668391 2015 Human RNase L tunes gene expression by selectively destabilizing the microRNA-regulated transcriptome.
26656695 2015 Suppression of NYVAC Infection in HeLa Cells Requires RNase L but Is Independent of Protein Kinase R Activity.
26517238 2015 RNase L is a negative regulator of cell migration.
26263979 2015 RNase L Cleavage Products Promote Switch from Autophagy to Apoptosis by Caspase-Mediated Cleavage of Beclin-1.
26236721 2015 Functional and Structural Consequences of Damaging Single Nucleotide Polymorphisms in Human Prostate Cancer Predisposition Gene RNASEL.
25540362 2015 RNase L targets distinct sites in influenza A virus RNAs.
25352621 2014 RNase L interacts with Filamin A to regulate actin dynamics and barrier function for viral entry.
25301952 2014 RNase L attenuates mitogen-stimulated gene expression via transcriptional and post-transcriptional mechanisms to limit the proliferative response.
25286525 [Clinical significance of interleukin-28B and RNAse L gene polymorphism determination in patients with chronic viral hepatitis C].
25275129 2014 The 2'-5'-oligoadenylate synthetase 3 enzyme potently synthesizes the 2'-5'-oligoadenylates required for RNase L activation.
24905202 2014 Viral phosphodiesterases that antagonize double-stranded RNA signaling to RNase L by degrading 2-5A.
24733098 2014 Enteropathogenic Escherichia coli inhibits type I interferon- and RNase L-mediated host defense to disrupt intestinal epithelial cell barrier function.
24699816 2014 RNASEL and MIR146A SNP-SNP interaction as a susceptibility factor for non-melanoma skin cancer.
24651439 2014 Defects in TLR3 expression and RNase L activation lead to decreased MnSOD expression and insulin resistance in muscle cells of obese people.
24578532 2014 Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
24224612 2014 Association of RNASEL and 8q24 variants with the presence and aggressiveness of hereditary and sporadic prostate cancer in a Hispanic population.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23382116 2013 A single nucleotide polymorphism in inflammatory gene RNASEL predicts outcome after radiation therapy for localized prostate cancer.
23196181 2013 The ribonuclease L-dependent antiviral roles of human 2',5'-oligoadenylate synthetase family members against hepatitis C virus.
23113544 2013 Regulation of human RNase-L by the miR-29 family reveals a novel oncogenic role in chronic myelogenous leukemia.
23109342 2012 RNase L induces autophagy via c-Jun N-terminal kinase and double-stranded RNA-dependent protein kinase signaling pathways.
23098452 2012 Evaluation of xenotropic murine leukemia virus and its R426Q polymorphism in patients with prostate cancer in Kerman, southeast of Iran.
23084743 2012 Innate immune messenger 2-5A tethers human RNase L into active high-order complexes.
22925698 2012 The association of elevated 2',5'-oligoadenylate-dependent RNase L with lung cancer correlated with deficient enzymatic activity and decreased capacity of RNase L dimerization.
22691533 2012 Structural changes of human RNase L upon homodimerization investigated by Raman spectroscopy.
22513284 2012 Positive selection on the gene RNASEL: correlation between patterns of evolution and function.
22464196 2012 [RNASEL study of genetics of prostate cancer and its relation to clinical staging].
22083266 2012 Predictive value in the analysis of RNASEL genotypes in relation to prostate cancer.
21846818 2011 Genetic variants in the LEPR, CRY1, RNASEL, IL4, and ARVCF genes are prognostic markers of prostate cancer-specific mortality.
21685539 2011 Lopinavir up-regulates expression of the antiviral protein ribonuclease L in human papillomavirus-positive cervical carcinoma cells.
21665181 2011 The effect of TP53 codon 72 and RNASEL codon 462 polymorphisms on the development of cervical cancer in Argentine women.
21656378 2012 RNASEL Asp541Glu and Arg462Gln polymorphisms in prostate cancer risk: evidences from a meta-analysis.
21360564 2011 Genetic variation in RNASEL and risk for prostate cancer in a population-based case-control study.
21221811 2011 RNASEL -1385G/A polymorphism and cancer risk: a meta-analysis based on 21 case-control studies.
20875083 2010 Association of RNase L with a Ras GTPase-activating-like protein IQGAP1 in mediating the apoptosis of a human cancer cell-line.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20576793 2010 Genetic variation in RNASEL associated with prostate cancer risk and progression.
20564318 2010 Contribution of HPC1 (RNASEL) and HPCX variants to prostate cancer in a founder population.
20410264 2010 Evaluation of cellular determinants required for in vitro xenotropic murine leukemia virus-related virus entry into human prostate cancer and noncancerous cells.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20086112 2010 Single and multivariate associations of MSR1, ELAC2, and RNASEL with prostate cancer in an ethnic diverse cohort of men.
19961052 2009 [G138A polymorphism of the RNASEL gene and its association with the development of prostate cancer. Preliminary study].
19923450 2009 Distinct antiviral roles for human 2',5'-oligoadenylate synthetase family members against dengue virus infection.
19853919 2009 Nucleotide oligomerization domain-2 interacts with 2'-5'-oligoadenylate synthetase type 2 and enhances RNase-L function in THP-1 cells.
19851509 2009 Endoribonuclease L (RNase L) regulates the myogenic and adipogenic potential of myogenic cells.
19760027 2009 Association of common polymorphisms in IL10, and in other genes related to inflammatory response and obesity with colorectal cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19267370 2009 Association of IL10 and other immune response- and obesity-related genes with prostate cancer in CLUE II.
19252527 2009 RNase L downmodulation of the RNA-binding protein, HuR, and cellular growth.
19245366 2009 MYPT1, the targeting subunit of smooth-muscle myosin phosphatase, is a substrate for the asparaginyl hydroxylase factor inhibiting hypoxia-inducible factor (FIH).
19223501 2009 Utility of incorporating genetic variants for the early detection of prostate cancer.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19088502 A putative loop E motif and an H-H kissing loop interaction are conserved and functional features in a group C enterovirus RNA that inhibits ribonuclease L.
18767027 2008 Association of HPC2/ELAC2 and RNASEL non-synonymous variants with prostate cancer risk in African American familial and sporadic cases.
18676870 2008 Variants in inflammation genes and the risk of biliary tract cancers and stones: a population-based study in China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18575592 2008 Germline mutation in RNASEL predicts increased risk of head and neck, uterine cervix and breast cancer.
18566991 2008 Joint effects of inflammation and androgen metabolism on prostate cancer severity.
18436282 2008 Analysis of the RNASEL/HPC1, and macrophage scavenger receptor 1 in Asian-Indian advanced prostate cancer.
18295551 2008 Molecular evolution of the prostate cancer susceptibility locus RNASEL: evidence for positive selection.
18289577 2008 Pathological aggressiveness of prostatic carcinomas related to RNASEL R462Q allelic variants.
18189233 2008 RNASEL and RNASEL-inhibitor variation and prostate cancer risk in Afro-Caribbeans.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17908993 2007 Association of RNASEL variants with prostate cancer risk in Hispanic Caucasians and African Americans.
17407163 2007 RNASEL Arg462Gln polymorphism and prostate cancer in PLCO.
17400356 Diverse functions of RNase L and implications in pathology.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17307214 2007 Interferon-induced inhibition of parainfluenza virus type 5; the roles of MxA, PKR and oligo A synthetase/RNase L.
17237228 2007 Post-transcriptional regulation of RNase-L expression is mediated by the 3'-untranslated region of its mRNA.
17234723 2007 Trans-fatty acid intake and increased risk of advanced prostate cancer: modification by RNASEL R462Q variant.
17224235 2007 The additive effect of p53 Arg72Pro and RNASEL Arg462Gln genotypes on age of disease onset in Lynch syndrome patients with pathogenic germline mutations in MSH2 or MLH1.
17200614 2004 Induction of the interferon-inducible RNA-degrading enzyme, RNase L, by stress-inducing agents in the human cervical carcinoma cells.
17150764 2005 Molecular basis for recognition of 2',5'-linked oligoadenylates by the N-terminal ankyrin repeat domain of human ribonuclease L.
17115900 2006 An alternative spliced RNASEL variant in peripheral blood leukocytes.
17020975 2006 RNASEL gene polymorphisms and the risk of prostate cancer: a meta-analysis.
16944274 2006 The 471delAAAG mutation and C353T polymorphism in the RNASEL gene in sporadic and inherited cancer in Israel.
16869093 2006 Involvement of the RNAse L gene in prostate cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16627618 2006 The primary function of RNA binding by the influenza A virus NS1 protein in infected cells: Inhibiting the 2'-5' oligo (A) synthetase/RNase L pathway.
16537704 2006 RNASEL mutation screening and association study in Ashkenazi and non-Ashkenazi prostate cancer patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16235172 2005 Single nucleotide polymorphisms in genes for 2'-5'-oligoadenylate synthetase and RNase L inpatients hospitalized with West Nile virus infection.
16234235 2005 Functional characterization of 2',5'-linked oligoadenylate binding determinant of human RNase L.
16203993 2005 A transcriptional signaling pathway in the IFN system mediated by 2'-5'-oligoadenylate activation of RNase L.
16166078 2005 Interaction between the androgen receptor and RNase L mediates a cross-talk between the interferon and androgen signaling pathways.
16156900 2005 Involvement of PKR and RNase L in translational control and induction of apoptosis after Hepatitis C polyprotein expression from a vaccinia virus recombinant.
16114055 2006 Association of hereditary prostate cancer gene polymorphic variants with sporadic aggressive prostate carcinoma.
15981205 2005 RNASEL germline variants are associated with pancreatic cancer.
15908960 2005 A newly discovered function for RNase L in regulating translation termination.
15849753 2005 2-5A induces a conformational change in the ankyrin-repeat domain of RNase L.
15824169 2005 Association of susceptibility alleles in ELAC2/HPC2, RNASEL/HPC1, and MSR1 with prostate cancer severity in European American and African American men.
15714208 2005 Mutation screening and association study of RNASEL as a prostate cancer susceptibility gene.
15534086 2004 Genetic analysis of the RNASEL gene in hereditary, familial, and sporadic prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385955 2004 Structural basis for recognition of 2',5'-linked oligoadenylates by human ribonuclease L.
15330212 Lack of association between RNASEL Arg462Gln variant and the risk of breast cancer.
15107989 2005 Varicella-zoster virus does not significantly induce cell defence mechanism mediated by the 2-5A/RNase L pathway during its replication cycle.
14695991 2004 Mutational analysis of susceptibility genes RNASEL/HPC1, ELAC2/HPC2, and MSR1 in sporadic prostate cancer.
14570908 2004 An apoptotic signaling pathway in the interferon antiviral response mediated by RNase L and c-Jun NH2-terminal kinase.
12915880 2003 Role of genetic polymorphisms of the RNASEL gene on familial prostate cancer risk in a Japanese population.
12653398 2001 African-American heredity prostate cancer study: a model for genetic research.
12624151 2003 The RNASEL 471delAAAG allele and prostate cancer in Ashkenazi Jewish men.
12590567 2003 Implications for RNase L in prostate cancer biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12415269 2002 RNASEL Arg462Gln variant is implicated in up to 13% of prostate cancer cases.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
12145743 2002 A novel founder mutation in the RNASEL gene, 471delAAAG, is associated with prostate cancer in Ashkenazi Jews.
12118002 2002 Ribonuclease L proteolysis in peripheral blood mononuclear cells of chronic fatigue syndrome patients.
12073768 Physical performance and prediction of 2-5A synthetase/RNase L antiviral pathway activity in patients with chronic fatigue syndrome.
12022038 2002 Analysis of the RNASEL gene in familial and sporadic prostate cancer.
11941539 2002 Germline alterations of the RNASEL gene, a candidate HPC1 gene at 1q25, in patients and families with prostate cancer.
11799394 2002 Germline mutations in the ribonuclease L gene in families showing linkage with HPC1.
11585831 2001 The 2-5A/RNase L/RNase L inhibitor (RLI) [correction of (RNI)] pathway regulates mitochondrial mRNAs stability in interferon alpha-treated H9 cells.
11333017 2001 Basis for regulated RNA cleavage by functional analysis of RNase L and Ire1p.
11063255 2000 Analysis and origins of the human and mouse RNase L genes: mediators of interferon action.
10708513 2000 A 6-Mb high-resolution physical and transcription map encompassing the hereditary prostate cancer 1 (HPC1) region.
10454983 1999 Controlling gene expression with 2-5A antisense.
9862963 1999 Alternative function of a protein kinase homology domain in 2', 5'-oligoadenylate dependent RNase L.
9856285 1998 The 2-5A system in viral infection and apoptosis.
9497242 1998 Linkage analysis of chromosome 1q markers in 136 prostate cancer families. The Cancer Research Campaign/British Prostate Group U.K. Familial Prostate Cancer Study Collaborators.
9366257 1997 Ribonucleases and host defense: identification, localization and gene expression in adherent monocytes in vitro.
8910276 1996 Major susceptibility locus for prostate cancer on chromosome 1 suggested by a genome-wide search.
7688298 1993 A dominant negative mutant of 2-5A-dependent RNase suppresses antiproliferative and antiviral effects of interferon.
7680958 1993 Expression cloning of 2-5A-dependent RNAase: a uniquely regulated mediator of interferon action.
7539425 1995 Cloning and characterization of a RNAse L inhibitor. A new component of the interferon-regulated 2-5A pathway.
7514601 1994 Intrinsic molecular activities of the interferon-induced 2-5A-dependent RNase.
7514564 1994 Localization of the interferon-induced, 2-5A-dependent RNase gene (RNS4) to human chromosome 1q25.
1565627 1992 Mendelian inheritance of familial prostate cancer.