Property Summary

Ligand Count 20
NCBI Gene PubMed Count 134
PubMed Score 525.76
PubTator Score 397.12

Knowledge Summary

Patent (24,366)

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.600 3.3e-05
cystic fibrosis 1.158 5.3e-05
gastric cancer 1.100 5.3e-03
hepatocellular carcinoma 1.800 6.4e-06
intraductal papillary-mucinous adenoma (... 1.100 1.0e-03
intraductal papillary-mucinous carcinoma... 1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.8e-02
juvenile dermatomyositis 1.053 1.7e-10
lung cancer -1.300 7.4e-03
medulloblastoma, large-cell -2.200 1.7e-03
osteosarcoma -1.002 3.7e-04
ovarian cancer -3.200 3.3e-10
pancreatic cancer 1.400 2.4e-03
pancreatic carcinoma 1.400 2.4e-03
spina bifida -1.013 3.9e-02

 OMIM Phenotype (1)

Gene RIF (132)

AA Sequence

MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMS      1 - 70
REDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKA     71 - 140
LKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHAL    141 - 210
LSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLA    211 - 280
VELKLKKIAELLCKRGASTDCGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDL    281 - 350
HRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF    351 - 420
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQN    421 - 490
ILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETK    491 - 560
DLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFD    561 - 630
KWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLV    631 - 700
IYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC                                 701 - 741
//

Text Mined References (141)

PMID Year Title