Property Summary

NCBI Gene PubMed Count 32
PubMed Score 9.78
PubTator Score 69.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.400 1.5e-04
osteosarcoma 1.603 7.8e-05
lung cancer 2.100 6.1e-04
ovarian cancer 1.600 2.3e-03

Gene RIF (15)

PMID Text
26159921 found that the 3' fragments of target pre-mRNA generated by ASO were almost completely degraded from their 5' ends by nuclear XRN2 after RNase H1-mediated cleavage
26094573 Altered RNaseH1 has a reduced capability to remove the RNA from RNA-DNA hybrids leading to impaired mtDNA replication and adult-onset mitochondrial encephalomyopathy.
25330849 RNaseH1 maintains regulated levels of telomeric RNA-DNA hybrids at ALT telomeres to trigger homologous recombination without compromising telomere integrity too severely
23990920 RNase H1 and protein P32 are involved in mitochondrial pre-rRNA processing
23078533 data implicate the H264 side chain in phosphodiester hydrolysis as well as in product release, and are consistent with a proposed model in which the RNAse H1 H264 side chain interacts with a divalent metal ion to support catalysis
21443203 On the basis of its nuclear magnetic resonance (NMR) nucleic acid structure, a boranophosphonate-modified, fully R(P) BH(3) DNA/RNA hybrid is predicted not to be a substrate for RNase H1.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18337749 Characterization of full-length enzymes with defective hybrid binding domain indicates that this domain dramatically enhances both the specific activity and processivity of RNase H1.
17964265 Report crystal structures of RNase H1 in complex with RNA/DNA hybrids.
17028158 THE role substrate structure plays in directing human RNase H1 activity as well as the design of effective antisense oligodeoxyribonucleotides.
17028157 method for enhancing the human RNase H1 activity of chimeric antisense oligonucleotides
15205459 analysis of catalytic site of human RNase H1 for heteroduplex substrate catalysis
14960586 in human cells RNase H1 is responsible for most of the activity of DNA-like antisense drugs
14506260 Human RNase H1 uses one tryptophan and two lysines to position the enzyme at the 3'-DNA/5'-RNA terminus of the heteroduplex substrate
12473655 The cysteine residues responsible for the redox-dependent activity of RNase H1 were determined by site-directed mutagenesis to involve Cys(147) and Cys(148), producing an inactive enzyme conformation by disulfide bond formation.

AA Sequence

MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAF      1 - 70
VRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFV     71 - 140
VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTD    141 - 210
SMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREG    211 - 280
AKQSED                                                                    281 - 286
//

Text Mined References (34)

PMID Year Title
26159921 2015 XRN2 is required for the degradation of target RNAs by RNase H1-dependent antisense oligonucleotides.
26094573 2015 RNASEH1 Mutations Impair mtDNA Replication and Cause Adult-Onset Mitochondrial Encephalomyopathy.
25330849 2014 RNaseH1 regulates TERRA-telomeric DNA hybrids and telomere maintenance in ALT tumour cells.
23990920 2013 Human RNase H1 is associated with protein P32 and is involved in mitochondrial pre-rRNA processing.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23078533 2012 Evidence for a dual functional role of a conserved histidine in RNA·DNA heteroduplex cleavage by human RNase H1.
21700224 2011 Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.
21443203 2011 Structural basis of the RNase H1 activity on stereo regular borano phosphonate DNA/RNA hybrids.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20823270 2010 An upstream open reading frame and the context of the two AUG codons affect the abundance of mitochondrial and nuclear RNase H1.
19228196 2009 Ribonuclease H: the enzymes in eukaryotes.
18337749 2008 Specific recognition of RNA/DNA hybrid and enhancement of human RNase H1 activity by HBD.
17964265 2007 Structure of human RNase H1 complexed with an RNA/DNA hybrid: insight into HIV reverse transcription.
17028158 2007 Human RNase H1 discriminates between subtle variations in the structure of the heteroduplex substrate.
17028157 2007 The positional influence of the helical geometry of the heteroduplex substrate on human RNase H1 catalysis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205459 2004 Structural requirements at the catalytic site of the heteroduplex substrate for human RNase H1 catalysis.
14960586 2004 Determination of the role of the human RNase H1 in the pharmacology of DNA-like antisense drugs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506260 2003 Human RNase H1 uses one tryptophan and two lysines to position the enzyme at the 3'-DNA/5'-RNA terminus of the heteroduplex substrate.
12667461 2003 Failure to produce mitochondrial DNA results in embryonic lethality in Rnaseh1 null mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473655 2003 Human RNase H1 activity is regulated by a unique redox switch formed between adjacent cysteines.
12036296 2002 Ribonuclease H1 maps to chromosome 2 and has at least three pseudogene loci in the human genome.
11856317 2002 The involvement of human ribonucleases H1 and H2 in the variation of response of cells to antisense phosphorothioate oligonucleotides.
10497183 1999 Properties of cloned and expressed human RNase H1.
9894807 1998 Cloning, subcellular localization and functional expression of human RNase HII.
9799596 1998 Cloning, expression, and mapping of ribonucleases H of human and mouse related to bacterial RNase HI.
9512096 1998 Molecular cloning and expression of cDNA for human RNase H.