Property Summary

NCBI Gene PubMed Count 25
PubMed Score 35.48
PubTator Score 40.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 6.2e-16
Atopic dermatitis 915 9.6e-05
spina bifida 1053 4.6e-02
Disease Target Count Z-score Confidence
Pityriasis versicolor 19 3.436 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.500 6.2e-16
Atopic dermatitis -1.700 9.6e-05
spina bifida -2.447 4.6e-02

Gene RIF (15)

AA Sequence

MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNT      1 - 70
FLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKK     71 - 140
DSQQFHLVPVHLDRVL                                                          141 - 156
//

Text Mined References (27)

PMID Year Title