Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.01
PubTator Score 6.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 2.5e-04
psoriasis -2.100 2.4e-04
glioblastoma 3.100 7.8e-05
osteosarcoma -1.322 4.1e-02
astrocytoma 2.000 4.8e-02
periodontitis 1.100 2.9e-24
medulloblastoma, large-cell -1.300 1.1e-03
adrenocortical carcinoma -1.879 2.2e-03
tuberculosis 1.500 7.9e-05
intraductal papillary-mucinous adenoma (... -1.700 1.2e-03
intraductal papillary-mucinous carcinoma... -1.900 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.600 2.2e-02
lung cancer -1.600 2.7e-04
interstitial cystitis 1.600 6.3e-03
group 4 medulloblastoma -1.200 8.2e-03
pilocytic astrocytoma 1.600 7.1e-06
primary Sjogren syndrome 1.900 2.3e-04
invasive ductal carcinoma 1.834 1.1e-04
lung carcinoma -1.400 3.9e-10
Alzheimer's disease 1.500 3.8e-02
Pick disease 1.500 2.7e-02
ulcerative colitis 1.900 3.6e-04
ovarian cancer -2.100 7.9e-07
head and neck cancer and chronic obstruc... 1.100 1.5e-03

Gene RIF (3)

PMID Text
25075772 Ribonucleases 6 is an antimicrobial peptide with activity against uropathogens and participates in the maintenance of urinary tract sterility.
24162774 HIV-1 gp120 downregulates the expression of ribonuclease K6 (RNASE6) in human B cells
23383108 HIV-1 gp120 downregulates the expression of ribonuclease K6 (RNASE6) in human B cells

AA Sequence

MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDS      1 - 70
FQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYK     71 - 140
LVPVHLDSIL                                                                141 - 150
//

Text Mined References (9)

PMID Year Title
25075772 2015 Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15676279 2005 The ribonuclease A superfamily of mammals and birds: identifying new members and tracing evolutionary histories.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9647635 1998 Ribonuclease k6: chromosomal mapping and divergent rates of evolution within the RNase A gene superfamily.
8836175 1996 Molecular cloning and characterization of a novel human ribonuclease (RNase k6): increasing diversity in the enlarging ribonuclease gene family.