Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.71
PubTator Score 15.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 733 0.0 0.0
Prostatic Neoplasms 472 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.1e-22

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.1e-22

Gene RIF (3)

AA Sequence

MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRF      1 - 70
NTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQ     71 - 140
VPVHFDG                                                                   141 - 147
//

Text Mined References (16)

PMID Year Title