Property Summary

NCBI Gene PubMed Count 107
PubMed Score 1993.54
PubTator Score 714.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.181 2.7e-02
osteosarcoma -6.557 8.7e-13
diabetes mellitus 1.800 1.2e-03
acute myeloid leukemia -2.300 4.5e-03

Gene RIF (89)

PMID Text
26600485 Children in the acute-phase group showed higher ECP mRNA expression level than those in the stable-phase and healthy control groups, while the level in the stable-phase was markedly higher than that in the healthy control group.
25463127 drug eluting stent polymers increase eosinophil cationic protein levels following percutaneous coronary intervention independently of C-reactive protein
25354326 Around half of all variance in serum ECP is explained by genetic factors. Serum ECP is influenced by sex, BMI, and airway responsiveness. Serum ECP and airway responsiveness seem not to share genetic variance.
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
24738159 report the prevalence of a common SNP in the eosinophil protein x/eosinophil-derived neurotoxin (EPX/EDN, RNase2) and the association with the cellular contents of EPX/EDN and ECP
24383969 Eosinophil cationic protein is not cytotoxic but enhances the growth of normal human dermal fibroblasts
24129707 eosinophil cationic protein levels can be used to diagnosis atopic dermatitis but cannot distinguish between intrinsic and extrinsic disease.
23841472 Effects of omalizumab on eosinophil cationic peptide, 25-hydroxyvitamin-D, IL-1beta and sCD200 in cases of Samter's syndrome
23786280 Eosinophil activation occurred in early and late responses after L-ASA NPT in upper airway mucosa of AERD patients, where ApoA1, alpha2M and CP as well as CysLT may be involved in eosinophilic inflammation.
23716047 The antimicrobial protein, Rnase 3, contributes to the host immune response against mycobacteria.
23710948 Eosinophil cationic protein is a major granule-derived protein with cytotoxic activity found in eosinophils and has been known as a useful marker of allergic inflammation.
23597768 A fraction of native ECP is stored in a non-cytotoxic form, which can be converted into a cytotoxic form by N-deglycosylation, whereas another fraction is stored as a highly cytotoxic form carrying different post-translational modifications
23517396 Lower ECP levels in the active phase of the disease may be a result of decreased production due to the activation of Th1 cytokines.
23484086 novel insights to identify functional regions of hRNase3 that may have implications for all hRNaseA superfamily members.
23430080 ECP was elevated in nasal discharge of patients with nasal polyps compared to controls and those with allergic rhinitis or rhinosinusitis.
23406588 This study also suggests that eosinophils and eosinophil cationic protein take part in the pathogenesis of nonallergic rhinitis.
23197886 Polymorphisms of EPX and ECP are associated to inflammatory bowel disease in an age and gender dependent manne.
23135272 The reduced conformational flexibility of eosinophil cationic protein can be dynamically and functionally reproduced in the RNase A scaffold.
22845733 biological and genetic characteristics of ECP
22845717 Eosinophil cationic protein might induce mesoderm differentiation through fibroblast growth factor signaling pathway and enhance subsequent cardiomyocyte differentiation in concert with dimethyl sulfoxide in P19CL6 cells.
22579681 Results reveal the structural basis for the high affinity of ECP for glycosaminoglycans.
22289536 Total serum IgE, ECP and eosinophil percentage are strong predictors of allergic rhinitis.
22216286 371G allele of RNASE3 is associated with susceptibility to cerebral malaria and forms part of a risk associated haplotype GGA defined by the markers
21962901 a marker of asthma severity within an asthmatic paediatric population
21878071 The data suggests presence of relationship between development of restenosis and elevated blood plasma Eosinophilic cation protein level in patients with IHD after revascularization.
21303303 Arg22, Arg34, Arg61, Arg77 and His64 of ECP are crucial for eosinophil cationic proteins's membrane destabilization activity, which appears to be the underlying mechanism of its cytotoxic, antibacterial and antiparasitic activities.
21183182 basal ECP levels are associated with major advemse cardiac evemts after bare metal stent implantation, suggesting that an allergic-mediated inflammation against the metal could explain some adverse reactions occurring after coronary stenting.
21038779 elevated levels in nasal lavage in allergic asthmatics
20951760 the shortest ECP minimized version that would retain its antimicrobial properties
20534163 There are associations of symptoms of allergy and asthma to ECP-genotypes, but also to smoking habits. ECP may be involved in impairment of lung functions in disease.
20534163 Observational study of gene-disease association. (HuGE Navigator)
20523065 Serum levels of ECP, IL-5, -6, -8 and -10, G-CSF, MCP-1, IL-1 ra and IP-10 were significantly elevated in acute compared with stable childhhood asthma.
20307883 Eosinophil cationic protein may have a role in coronary atherosclerosis
20213669 ECP heparin binding affinity depends on its RNase catalytic site
20170318 The mean of serum ECP was significantly higher in patients with respiratory tract diseases (asthma, COPD, interstitial lung disease, and respiratory infections) compared with healthy volunteers.
20089176 The eosinophil cationic protein increased TNF-alpha production in BEAS-2B cells and triggered apoptosis by caspase-8 activation through mitochondria-independent pathway.
19760211 Our study suggests that RNase3 polymorphisms are potentially associated with susceptibility to allergic rhinitis.
19760211 Observational study of gene-disease association. (HuGE Navigator)
19717523 ECP and EDN disrupt skin integrity and cause inflammation
19692640 Secretion of ECP from eosinophils involves protein modification partly explained by differences in N-linked glycosylations
19639743 elevated serum levels in patients with eosinophilic esophagitis
19566743 Results showed that OSCC patients with intense TATE and at least one C allele had a higher frequency of bilateral neck dissection, local recurrence, vascular embolization, involved resection margins, and postoperative radiotherapy.
19542456 The ECP 434(G>C) polymorphism alters ECP function in that the arginine97threonine substitution impairs the cytotoxic potential of ECP, but less the gel contraction, and not at all the RNase activity.
19521893 ECP may function as a cardiomyocyte differentiation factor
19476022 decreased levels following alpine mountain climate therapy in patients with allergic diseases and chronic obstructive pulmonary disease
19450231 Bactericidal and membrane disruption activities of the eosinophil cationic protein are located in N-terminal.
19366593 Using phospholipid vesicles as membrane models, RNase 3 triggers first the vesicle aggregation, while RNase 7 induces leakage well before the aggregation step.
19284504 ECP stimulates migration of human lung fibroblasts
19189375 Data show that conformational diversity of ECP is observed for the loop segments 17-22, 65-68, and 92-95 and most exposed sidechains.
19133919 Serum eosinophil cationic protein and eosinophil peroxidase in patients with seasonal rhinitis demonstrated a high predictive ability for later development of asthma.
19086659 The expression level of ECP mRNA was up-regulated in nasal polyps.
19014520 No variation in genes eosinophil cationic protein for Atopic dermatitis pathogenesis in this German cohort.
19014520 Observational study of gene-disease association. (HuGE Navigator)
18716399 These results may indicate the absence of a correlation between clinical status and quality of life and levels of eosinophilic cationic protein in tissues with allergic inflammation.
18657051 higher expression levels in adenoid tissue of children with house dust mite allergies
18593710 the tight interaction between ECP and heparin acts as the primary step for ECP endocytosis
18345486 Results describe the release of eosinophil cationic protein from intact tissue biopsies from patients with nasal polyps.
18293932 ECP can bind with high affinity to the bacteria-wall components, a first-encounter step which is key to its antimicrobial mechanism of action.
18087674 The cytotoxic effect of ECP is attained through a mechanism different from that of other cytotoxic RNases and may be related with the ECP accumulation associated with the inflammatory processes, in which eosinophils are present.
17944807 cell surface-bound heparan sulfate proteoglycans serve as the major receptor for ECP internalization
17927842 Transcriptional regulation of human eosinophil RNases by an evolutionary- conserved sequence motif in primate genome.
17885861 Eosinophil cationic protein may serve as a possible contributor to the pathophysiology of exercise-induced bronchoconstriction in asthmatic children.
17852809 Determined faecal and serum ECP levels add background information concerning reference levels at paediatric age for further studies indifferent clinical settings.
17804567 ECP might be used as a disease activity marker in Churg-Strauss syndrome
17726151 Both genetic and post-translational causes of the molecular heterogeneity of the eosinophil cationic protein, was detected.
17675527 neutrophils from allergic patients were able to produce ECP by an IgE-dependent mechanism.
17587163 ECP stimulates TGF-beta(1)-release by human lung fibroblasts, suggesting a potential mechanism for eosinophils in the fibrotic response.
17573858 In the asthma group, there was no correlation between methacholine end-point concentration and the eosinophil counts or serum ECP levels. In contrast, AMP end-point concentration correlated with the eosinophil counts and with serum ECP levels.
17507019 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17362255 Observational study of gene-disease association. (HuGE Navigator)
17362255 the A-G-G haplotype in the RNASE3 gene influences the development of asthma, in particular, an allergic form of asthma
17250693 study concludes that ECP is present in several molecular forms with varying biological activities; some of this functional heterogeneity is based on the genetic polymorphism of the ECP gene and some on post-translational modifications
17223693 Tryptophan solvent exposure and the depth of the protein insertion in the lipid bilayer were monitored by the degree of protein fluorescence quenching by KI and brominated phospholipids, respectively.
17088327 The high thermal stability of ECP may contribute to its resistance to degradation when the protein is secreted to the extracellular medium during the immune response.
16883790 ECP is present in the middle ear effusion of otitis media of effusion. There was a positive correlation between ECP level and IgE level.
16879306 These results demonstrate that eosinophils degranulate in vivo at the host-parasite interface, and that the released ECP reaches concentrations that could be harmful for the parasite, Echinococcus granulosus.
16874959 Among mite-allergic patients T-bet expression was down-regulated, which had no relation to ECP concentration and allergic symptoms.
16014847 Observational study of gene-disease association. (HuGE Navigator)
16010966 The involvement of some cationic and aromatic surface exposed residues of eosinophil cationic protein in the inhibition of proliferation of mammalian cell lines was assessed.
15928844 serum ECP asthma patients, during and after a mild pollen season
15317478 conformational transitions at the level of sidechain interactions
15295703 The presence of Torque tenovirus (TTV) and TTV load correlate with concentrations of serum eosinophil cationic protein in children with acute respiratory disease
15007353 ECP contributes to surfactant dysfunction in asthma, which in turn could lead to airway obstruction.
14630983 Presence of ECP in human milk is associated with development of cow milk allergy and atopic dermatitis in the breast-fed infant, but has no direct association with the maternal atopy.
12974194 results suggest a differential release of ECP by the serum eosinophil, depending on the disease status and asthma exacerbation severity
12530121 serum levels elevated in asthmatic patients during acute attack
12524255 Measurement of ECP polymorphism is a significant indicator for the disease activity in asthmatic patient.
12100059 Observational study of gene-disease association. (HuGE Navigator)
11959927 EDN and ECP are paralogs in human and Old World monkeys.

AA Sequence

MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTF      1 - 70
LRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDN     71 - 140
RDPRDSPRYPVVPVHLDTTI                                                      141 - 160
//

Text Mined References (111)

PMID Year Title
26600485 2015 Eosinophil cationic protein mRNA expression in children with bronchial asthma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25463127 2014 Permanent polymer of drug eluting stents increases eosinophil cationic protein levels following percutaneous coronary intervention independently of C-reactive protein.
25354326 2014 Genetic factors explain half of all variance in serum eosinophil cationic protein.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24738159 2014 The production of the eosinophil proteins ECP and EPX/EDN are regulated in a reciprocal manner.
24383969 2013 Cytokine expression in human dermal fibroblasts stimulated with eosinophil cationic protein measured by protein array.
24129707 2014 Utility of eosinophil cationic protein levels in the diagnosis of intrinsic atopic dermatitis.
23841472 2013 Effects of omalizumab on eosinophil cationic peptide, 25-hydroxyvitamin-D, IL-1? and sCD200 in cases of Samter's syndrome: 36 months follow-up.
23786280 2013 Eosinophil activation and novel mediators in the aspirin-induced nasal response in AERD.
23716047 2013 Two human host defense ribonucleases against mycobacteria, the eosinophil cationic protein (RNase 3) and RNase 7.
23710948 Analyzing serum eosinophil cationic protein in the clinical assessment of chronic rhinosinusitis.
23597768 2013 Asparagine-linked glycans determine the cytotoxic capacity of eosinophil cationic protein (ECP).
23517396 2013 Serum eosinophil cationic protein levels in Behçet's disease and its relation to clinical activity.
23484086 2013 In silico prediction and in vitro characterization of multifunctional human RNase3.
23430080 2013 Eosinophils and mast cells: a comparison of nasal mucosa histology and cytology to markers in nasal discharge in patients with chronic sino-nasal diseases.
23406588 2013 Serum eosinophil cationic protein level in Chinese subjects with nonallergic and local allergic rhinitis and its relation to the severity of disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23197886 2012 Eosinophil associated genes in the inflammatory bowel disease 4 region: correlation to inflammatory bowel disease revealed.
23135272 2012 Conservation of flexible residue clusters among structural and functional enzyme homologues.
22845733 2012 Eosinophil cationic protein: overview of biological and genetic features.
22845717 2012 Eosinophil cationic protein enhances cardiomyocyte differentiation of P19CL6 embryonal carcinoma cells by stimulating the FGF receptor signaling pathway.
22579681 2012 The sulfate-binding site structure of the human eosinophil cationic protein as revealed by a new crystal form.
22289536 2011 Predictive capabilities of serum eosinophil cationic protein, percentage of eosinophils and total immunoglobulin E in allergic rhinitis without bronchial asthma.
22216286 2011 Polymorphisms in the RNASE3 gene are associated with susceptibility to cerebral malaria in Ghanaian children.
21962901 Eosinophilic activity and bronchial hyperresponsiveness within an asthmatic paediatric population.
21878071 2011 [Eosinophilic cation protein and development of restenosis of drug covered stents].
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21303303 2011 Role of unique basic residues in cytotoxic, antibacterial and antiparasitic activities of human eosinophil cationic protein.
21183182 2011 Eosinophil cationic protein and clinical outcome after bare metal stent implantation.
21038779 The value and safety of specific nasal provocation in the diagnosis of allergic rhinitis in mild persistent asthma under inhaled steroid therapy.
20951760 2011 Mapping the eosinophil cationic protein antimicrobial activity by chemical and enzymatic cleavage.
20690710 2010 Eosinophil cationic protein aggregation: identification of an N-terminus amyloid prone region.
20534163 2010 Associations of ECP (eosinophil cationic protein)-gene polymorphisms to allergy, asthma, smoke habits and lung function in two Estonian and Swedish sub cohorts of the ECRHS II study.
20523065 2010 Serum eosinophil cationic protein and 27 cytokines/chemokines in acute exacerbation of childhood asthma.
20307883 2010 Eosinophil cationic protein: A new biomarker of coronary atherosclerosis.
20213669 Eosinophil cationic protein (ECP) can bind heparin and other glycosaminoglycans through its RNase active site.
20170318 2010 Serum eosinophilic cationic protein: is there a role in respiratory disorders?
20089176 2010 TNF-alpha mediates eosinophil cationic protein-induced apoptosis in BEAS-2B cells.
19760211 2010 Identification of polymorphisms in the RNase3 gene and the association with allergic rhinitis.
19717523 2009 Eosinophil ribonucleases and their cutaneous lesion-forming activity.
19692640 2009 Eosinophil cationic protein (ECP) is processed during secretion.
19639743 2009 Eosinophilic esophagitis due to profilin allergy.
19566743 2010 The 434(G>C) polymorphism in the eosinophil cationic protein gene and its association with tissue eosinophilia in oral squamous cell carcinomas.
19542456 2009 The coding ECP 434(G>C) gene polymorphism determines the cytotoxicity of ECP but has minor effects on fibroblast-mediated gel contraction and no effect on RNase activity.
19521893 2009 Human eosinophil cationic protein enhances stress fiber formation in Balb/c 3T3 fibroblasts and differentiation of rat neonatal cardiomyocytes.
19476022 2009 Benefits of alpine mountain climate of Bavaria in patients with allergic diseases and chronic obstructive pulmonary disease: results from the AURA* study.
19450231 2009 Bactericidal and membrane disruption activities of the eosinophil cationic protein are largely retained in an N-terminal fragment.
19366593 2009 Comparison of the membrane interaction mechanism of two antimicrobial RNases: RNase 3/ECP and RNase 7.
19284504 2009 Eosinophil cationic protein stimulates migration of human lung fibroblasts in vitro.
19189375 2009 The (1)H, (13)C, (15)N resonance assignment, solution structure, and residue level stability of eosinophil cationic protein/RNase 3 determined by NMR spectroscopy.
19133919 2009 Serum eosinophil granule proteins predict asthma risk in allergic rhinitis.
19086659 2008 [Observation of ultrastructure and ECP expression in nasal polyps].
19014520 2008 Variation in genes encoding eosinophil granule proteins in atopic dermatitis patients from Germany.
18716399 2009 Correlation of quality of life with clinical parameters and eosinophilic cation protein levels in children with allergic rhinoconjunctivitis.
18694936 2008 Post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase.
18657051 2009 Local production of total IgE and specific antibodies to the house dust mite in adenoid tissue.
18593710 2008 Characterization of molecular interactions between eosinophil cationic protein and heparin.
18345486 2008 Evaluation of ECP release from intact tissue biopsies from patients with nasal polyps.
18293932 2008 Eosinophil cationic protein high-affinity binding to bacteria-wall lipopolysaccharides and peptidoglycans.
18087674 2008 The cytotoxicity of eosinophil cationic protein/ribonuclease 3 on eukaryotic cell lines takes place through its aggregation on the cell membrane.
17944807 2007 A heparan sulfate-facilitated and raft-dependent macropinocytosis of eosinophil cationic protein.
17927842 2007 Transcriptional regulation of human eosinophil RNases by an evolutionary- conserved sequence motif in primate genome.
17885861 2007 Changes in serum eosinophil cationic protein levels after exercise challenge in asthmatic children.
17852809 2007 Faecal and serum levels of eosinophil cationic protein in a healthy paediatric population.
17804567 2007 Serum eosinophil cationic protein: a marker of disease activity in Churg-Strauss syndrome.
17726151 2007 A SELDI-TOF MS study of the genetic and post-translational molecular heterogeneity of eosinophil cationic protein.
17675527 2007 Neutrophils as a novel source of eosinophil cationic protein in IgE-mediated processes.
17587163 2007 Eosinophil cationic protein stimulates TGF-beta1 release by human lung fibroblasts in vitro.
17573858 2007 Bronchial responsiveness to methacholine and adenosine 5'-monophosphate in young children with asthma: their relationship with blood eosinophils and serum eosinophil cationic protein.
17507019 2007 The 434(G>C) polymorphism within the coding sequence of Eosinophil Cationic Protein (ECP) correlates with the natural course of Schistosoma mansoni infection.
17362255 2007 Eosinophil cationic protein (ECP) polymorphisms and association with asthma, s-ECP levels and related phenotypes.
17250693 2007 The functional heterogeneity of eosinophil cationic protein is determined by a gene polymorphism and post-translational modifications.
17223693 2007 Topography studies on the membrane interaction mechanism of the eosinophil cationic protein.
17088327 2006 Thermal unfolding of eosinophil cationic protein/ribonuclease 3: a nonreversible process.
16883790 2006 [The measuring of ECP and IgE in middle ear effusion of patients with otitis media of effusion].
16879306 2006 Eosinophil cationic protein damages protoscoleces in vitro and is present in the hydatid cyst.
16874959 2005 [Expression of T-bet and its relation with IgE and eosinophil cationic protein in patients with allergic rhinitis].
16014847 2005 Genetic polymorphisms of eosinophil-derived neurotoxin and eosinophil cationic protein in tropical pulmonary eosinophilia.
16010966 2005 Surface-exposed amino acids of eosinophil cationic protein play a critical role in the inhibition of mammalian cell proliferation.
15928844 2005 Histamine release from blood cells and serum ECP in patients with asthma, during and after a mild pollen season.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15317478 2004 Conformational transitions in eosinophil cationic protein: a molecular dynamics study in aqueous environment.
15295703 2004 Correlation between Torque tenovirus infection and serum levels of eosinophil cationic protein in children hospitalized for acute respiratory diseases.
15007353 2004 Eosinophil cationic protein alters pulmonary surfactant structure and function in asthma.
14630983 2004 Eosinophil cationic protein in human milk is associated with development of cow's milk allergy and atopic eczema in breast-fed infants.
12974194 Ratio of serum eosinophil cationic protein/blood eosinophil counts in children with asthma: comparison between acute exacerbation and clinical remission.
12860195 2003 Antimicrobial peptides in the first line defence of human colon mucosa.
12530121 2002 Elevation of serum eosinophil cationic protein, soluble tumor necrosis factor receptors and soluble intercellular adhesion molecule-1 levels in acute bronchial asthma.
12524255 2003 The promoter polymorphism in the eosinophil cationic protein gene and its influence on the serum eosinophil cationic protein level.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356310 2002 The crystal structure of eosinophil cationic protein in complex with 2',5'-ADP at 2.0 A resolution reveals the details of the ribonucleolytic active site.
12100059 2002 Polymorphism of the eosinophil cationic protein-gene is related to the expression of allergic symptoms.
11959927 2002 The past as the key to the present: resurrection of ancient proteins from eosinophils.
11552948 Monocytes, but not macrophages, produce the eosinophil cationic protein.
11404391 2001 Identification and characterization of human eosinophil cationic protein by an epitope-specific antibody.
11102386 2000 Sequence variation at two eosinophil-associated ribonuclease loci in humans.
11034418 2000 Eosinophils maintain their capacity to signal and release eosinophil cationic protein upon repetitive stimulation with the same agonist.
10903870 2000 Three-dimensional crystal structure of human eosinophil cationic protein (RNase 3) at 1.75 A resolution.
10706854 2000 Eotaxin induces degranulation and chemotaxis of eosinophils through the activation of ERK2 and p38 mitogen-activated protein kinases.
10606511 1999 Crystal structure of eosinophil cationic protein at 2.4 A resolution.
10336457 1999 Kinetic and product distribution analysis of human eosinophil cationic protein indicates a subsite arrangement that favors exonuclease-type activity.
3520144 1986 Localization of human eosinophil granule major basic protein, eosinophil cationic protein, and eosinophil-derived neurotoxin by immunoelectron microscopy.
3458170 1986 Biochemical and functional similarities between human eosinophil-derived neurotoxin and eosinophil cationic protein: homology with ribonuclease.
2745977 1989 Eosinophil cationic protein cDNA. Comparison with other toxic cationic proteins and ribonucleases.
2501794 1989 Antibiotic proteins of human polymorphonuclear leukocytes.
2473157 1989 Human eosinophil cationic protein. Molecular cloning of a cytotoxin and helminthotoxin with ribonuclease activity.
2387583 1990 Structure and chromosome localization of the human eosinophil-derived neurotoxin and eosinophil cationic protein genes: evidence for intronless coding sequences in the ribonuclease gene superfamily.
1577491 1992 Localization of the human eosinophil Charcot-Leyden crystal protein (lysophospholipase) gene (CLC) to chromosome 19 and the human ribonuclease 2 (eosinophil-derived neurotoxin) and ribonuclease 3 (eosinophil cationic protein) genes (RNS2 and RNS3) to chromosome 14.
1464733 1992 Eosinophil granule proteins in peripheral blood granulocytes.