Property Summary

NCBI Gene PubMed Count 113
PubMed Score 2019.23
PubTator Score 714.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -2.300 4.5e-03
diabetes mellitus 1.800 1.2e-03
osteosarcoma -6.557 8.7e-13
Waldenstrons macroglobulinemia 2.181 2.7e-02

PDB (11)

Gene RIF (94)

AA Sequence

MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTF      1 - 70
LRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDN     71 - 140
RDPRDSPRYPVVPVHLDTTI                                                      141 - 160
//

Text Mined References (117)

PMID Year Title