Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Synonym

Accession Q5GAN4
Symbols RAI1
HEL-S-85p

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 HCA RNA Cell Line (3)

AA Sequence

MIIMVIIFLVLLFWENEVNDEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDHTCKKEHVFIH      1 - 70
ERPRKINGICISPKKVACQNLSAIFCFQSETKFKMTVCQLIEGTRYPACRYHYSPTEGFVLVTCDDLRPD     71 - 140
SFLGYVK                                                                   141 - 147
//

Text Mined References (4)

PMID Year Title