Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.03
PubTator Score 9.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 2.2e-02
ependymoma -1.500 4.8e-02
interstitial cystitis -1.100 4.8e-03
medulloblastoma, large-cell 1.100 2.5e-02
osteosarcoma 1.093 2.8e-04
ovarian cancer -1.100 3.0e-04
psoriasis -1.300 2.7e-03

Gene RIF (6)

AA Sequence

MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEM      1 - 70
NQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQD     71 - 140
FPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVTSLPRDAANIL    141 - 210
VMGVENSAKEGDPGTIFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQS    211 - 280
KLHRGEIKLNSELDLDDAILEKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVM    281 - 350
QKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMELTDLMRNHL    351 - 420
NEKRALRLEWMIVILITIEVMFELGRVFF                                             421 - 449
//

Text Mined References (19)

PMID Year Title