Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.11
PubTator Score 16.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.100 4.2e-03
ependymoma -1.400 2.8e-03
oligodendroglioma -1.400 1.5e-03
osteosarcoma -1.817 1.0e-03
adrenocortical carcinoma 2.484 4.3e-07
non-small cell lung cancer 2.700 9.3e-27
interstitial cystitis -1.100 1.2e-03
atypical teratoid/rhabdoid tumor 1.300 4.9e-04
lung adenocarcinoma 1.200 1.1e-05
nasopharyngeal carcinoma 1.100 1.7e-04
inflammatory breast cancer 1.500 7.1e-03
ductal carcinoma in situ 1.300 3.2e-03
invasive ductal carcinoma 2.300 3.3e-04
ovarian cancer 2.200 1.4e-08

Gene RIF (4)

PMID Text
25200081 The results show that Topo IIIalpha stimulates DNA unwinding by BLM in a manner that is potentiated by RMI1-RMI2, and that the processivity of resection is reliant on the Topo IIIalpha-RMI1-RMI2 complex.
24108125 two proteins that interact with BLM, RMI1 and RMI2, are phosphorylated upon SAC activation, and, like BLM, RMI1, and RMI2, are phosphorylated in an MPS1-dependent manner.
20826342 Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRG      1 - 70
EARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVE     71 - 140
DLHRNIP                                                                   141 - 147
//

Text Mined References (17)

PMID Year Title
25200081 2014 Multifaceted role of the Topo III?-RMI1-RMI2 complex and DNA2 in the BLM-dependent pathway of DNA break end resection.
24108125 2013 Monopolar spindle 1 (MPS1) protein-dependent phosphorylation of RecQ-mediated genome instability protein 2 (RMI2) at serine 112 is essential for BLM-Topo III ?-RMI1-RMI2 (BTR) protein complex function upon spindle assembly checkpoint (SAC) activation during mitosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20826342 2010 Crystal structures of RMI1 and RMI2, two OB-fold regulatory subunits of the BLM complex.
20826341 2010 Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18978792 2008 Meta-analysis of genome-wide association study data identifies additional type 1 diabetes risk loci.
18923083 2008 BLAP18/RMI2, a novel OB-fold-containing protein, is an essential component of the Bloom helicase-double Holliday junction dissolvasome.
18923082 2008 RMI, a new OB-fold complex essential for Bloom syndrome protein to maintain genome stability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.