Property Summary

NCBI Gene PubMed Count 25
PubMed Score 21.58
PubTator Score 24.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 1.2e-03

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -1.800 1.2e-03

Gene RIF (14)

PMID Text
25862004 High PTPIP51 expression is associated with glioblastoma.
24501773 PTPIP51 is regulated by its phosphorylation status combined with a thereby induced subcellular redistribution.
22544307 The presented data confirms a tyrosine phosphorylation-dependent interaction of PTPIP51 with 14-3-3beta and Raf-1 in vivo and a tyrosine-dependent interaction profile with DAGKalpha and PKA.
21972092 In glioblastoma PTPIP51 expression increases with the grade of malignancy and PTPIP51 interacts in situ with 14-3-3ss and PTP1B.
21513978 PTPIP51 is phosphorylated by Lyn and c-Src kinases lacking dephosphorylation by PTP1B in acute myeloid leukemia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20627780 PTPIP51 expression was restricted to myeloid precursor cells undergoing differentiation. In blood cells therefore, PTPIP51 expression is restricted to differentiating and mature neutrophil granulocytes.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19691131 The promoter methylation status of PTPIP51 seems to influence the expression of PTPIP51, which was seen as elevated in the prostate carcinoma.
19124842 The results clearly point toward a strong association between PTPIP51 expression and differentiation in human muscle cells.
19012732 FAM82A2 is expressed in keratinocyte carcinoma and their surrounding stroma.
18854601 PTPIP51 and PTP1B, play a role in differentiation and apoptosis of the cytotrophoblast and syncytiotrophoblast, respectively. Moreover, PTPIP51 may also serve as a cellular signaling partner in angiogenesis and vascular remodeling.
16820967 PTPIP51 is a mitochondrial protein with apoptosis-inducing function and that the N-terminal TM domain is required for both the correct targeting of the protein to mitochondria and its apoptotic functions.
15609043 PTPIP51 might be involved in the regulation of cellular processes associated with differentiation, movement, or cytoskeletal organization

AA Sequence

MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVP      1 - 70
GGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGEVRCHMEENQRVARRR     71 - 140
RFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTANAESDNERDSDKESEDGEDEVSCETVKMGRK    141 - 210
DSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRL    211 - 280
ARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKE    281 - 350
HVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAG    351 - 420
RVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD                        421 - 470
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862004 2015 PTPIP51 levels in glioblastoma cells depend on inhibition of the EGF-receptor.
24501773 2014 The known interactome of PTPIP51 in HaCaT cells—inhibition of kinases and receptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22544307 2012 PTPIP51 in protein interactions: regulation and in situ interacting partners.
22131369 2012 VAPB interacts with the mitochondrial protein PTPIP51 to regulate calcium homeostasis.
21972092 2011 PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3? and PTP1B in situ.
21513978 2011 PTPIP51 is phosphorylated by Lyn and c-Src kinases lacking dephosphorylation by PTP1B in acute myeloid leukemia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20936779 2010 A human MAP kinase interactome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20627780 2010 PTPIP51-a myeloid lineage specific protein interacts with PTP1B in neutrophil granulocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19691131 2009 PTPIP51 mRNA and protein expression in tissue microarrays and promoter methylation of benign prostate hyperplasia and prostate carcinoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19124842 2009 Differentiation-dependent PTPIP51 expression in human skeletal muscle cell culture.
19012732 2008 The novel protein PTPIP51 is expressed in human keratinocyte carcinomas and their surrounding stroma.
18854601 2009 Protein tyrosine phosphatase interacting protein 51 (PTPIP51) mRNA expression and localization and its in vitro interacting partner protein tyrosine phosphatase 1B (PTP1B) in human placenta of the first, second, and third trimester.
18771726 2008 PTPIP51, a novel 14-3-3 binding protein, regulates cell morphology and motility via Raf-ERK pathway.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18070910 2007 RMD-1, a novel microtubule-associated protein, functions in chromosome segregation in Caenorhabditis elegans.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17361080 2006 Epidermal growth factor-, transforming growth factor-beta-, retinoic acid- and 1,25-dihydroxyvitamin D3-regulated expression of the novel protein PTPIP51 in keratinocytes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16820967 2006 Protein tyrosine phosphatase interacting protein 51 (PTPIP51) is a novel mitochondria protein with an N-terminal mitochondrial targeting sequence and induces apoptosis.
15609043 2005 The novel protein PTPIP51 exhibits tissue- and cell-specific expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.