Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.87
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.800 6.0e-05
astrocytic glioma -1.200 2.0e-02
atypical teratoid / rhabdoid tumor -2.500 5.1e-09
ependymoma -1.600 2.2e-02
glioblastoma -1.400 7.0e-04
primitive neuroectodermal tumor -1.500 9.4e-03
subependymal giant cell astrocytoma -1.869 2.5e-03

Synonym

Accession Q5TAB7 Q5TAB6
Symbols SCDO6
C6orf159
dJ237I15.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASG      1 - 70
KLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEDLTCEN                 71 - 128
//

Text Mined References (13)

PMID Year Title