Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.87
PubTator Score 0.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.200 2.0e-02
ependymoma -2.400 7.7e-18
glioblastoma -2.000 6.7e-04
atypical teratoid / rhabdoid tumor -2.500 5.1e-09
primitive neuroectodermal tumor -1.500 9.4e-03
adult high grade glioma -1.800 6.0e-05
subependymal giant cell astrocytoma -1.869 2.5e-03

Synonym

Accession Q5TAB7 Q5TAB6
Symbols SCDO6
C6orf159
dJ237I15.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20511563 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17531978 Functional analysis of the mouse Ripply2 ortholog.
16326386 Compares Ripply proteins in zebrafish, mouse, human, and amphioxus.

AA Sequence

MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASG      1 - 70
KLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEDLTCEN                 71 - 128
//

Text Mined References (13)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26238661 2015 Rare variants in the notch signaling pathway describe a novel type of autosomal recessive Klippel-Feil syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
25343988 2015 Compound heterozygous mutations in RIPPLY2 associated with vertebral segmentation defects.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20511563 2010 Novel cleft susceptibility genes in chromosome 6q.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17531978 2007 Ripply2 is essential for precise somite formation during mouse early development.
16341674 2005 Transcriptome analysis of human gastric cancer.
16326386 2005 Groucho-associated transcriptional repressor ripply1 is required for proper transition from the presomitic mesoderm to somites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.