Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.81
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytoma -1.700 2.2e-15
Astrocytoma, Pilocytic -1.700 3.3e-03
cutaneous lupus erythematosus 1.700 5.3e-03
cystic fibrosis -1.900 2.1e-02
dermatomyositis 1.300 1.8e-03
glioblastoma -1.600 4.5e-03
interstitial cystitis 1.900 2.0e-03
juvenile dermatomyositis 1.137 3.7e-07
lung adenocarcinoma -1.100 7.7e-09
lung carcinoma -2.000 5.1e-23
medulloblastoma, large-cell -2.800 3.0e-04
nasopharyngeal carcinoma -2.000 2.1e-03
non-small cell lung cancer -1.417 2.9e-11
oligodendroglioma -1.800 2.1e-02
osteosarcoma -1.976 4.6e-02
ovarian cancer -3.000 1.2e-07
pediatric high grade glioma -1.600 5.6e-03
posterior fossa group A ependymoma -1.800 2.2e-04
primary Sjogren syndrome 2.000 1.4e-04
severe Alzheimer's disease -1.141 3.0e-02
spina bifida -1.328 3.7e-02
tuberculosis 1.100 3.7e-03
ulcerative colitis 2.200 5.4e-04
Waldenstrons macroglobulinemia -1.814 4.0e-02

 GO Function (1)

Gene RIF (7)

AA Sequence

MLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRSRCNSFIENSSALKKPQAKLKKMHNLGHKNNNPPKEPQ      1 - 70
PKRVEEVYRALKNGLDEYLEVHQTELDKLTAQLKDMKRNSRLGVLYDLDKQIKTIERYMRRLEFHISKVD     71 - 140
ELYEAYCIQRRLQDGASKMKQAFATSPASKAARESLTEINRSFKEYTENMCTIEVELENLLGEFSIKMKG    141 - 210
LAGFARLCPGDQYEIFMKYGRQRWKLKGKIEVNGKQSWDGEETVFLPLIVGFISIKVTELKGLATHILVG    211 - 280
SVTCETKELFAARPQVVAVDINDLGTIKLNLEITWYPFDVEDMTASSGAGNKAAALQRRMSMYSQGTPET    281 - 350
PTFKDHSFFRWLHPSPDKPRRLSVLSALQDTFFAKLHRSRSFSDLPSLRPSPKAVLELYSNLPDDIFENG    351 - 420
KAAEEKMPLSLSFSDLPNGDCALTSHSTGSPSNSTNPEITITPAEFNLSSLASQNEGMDDTSSASSRNSL    421 - 490
GEGQEPKSHLKEEDPEEPRKPASAPSEACRRQSSGAGAEHLFLENDVAEALLQESEEASELKPVELDTSE    491 - 560
GNITKQLVKRLTSAEVPMATDRLLSEGSVGGESEGCRSFLDGSLEDAFNGLLLALEPHKEQYKEFQDLNQ    561 - 630
EVMNLDDILKCKPAVSRSRSSSLSLTVESALESFDFLNTSDFDEEEDGDEVCNVGGGADSVFSDTETEKH    631 - 700
SYRSVHPEARGHLSEALTEDTGVGTSVAGSPLPLTTGNESLDITIVRHLQYCTQLVQQIVFSSKTPFVAR    701 - 770
SLLEKLSRQIQVMEKLAAVSDENIGNISSVVEAIPEFHKKLSLLSFWTKCCSPVGVYHSPADRVMKQLEA    771 - 840
SFARTVNKEYPGLADPVFRTLVSQILDRAEPLLSSSLSSEVVTVFQYYSYFTSHGVSDLESYLSQLARQV    841 - 910
SMVQTLQSLRDEKLLQTMSDLAPSNLLAQQEVLRTLALLLTREDNEVSEAVTLYLAAASKNQHFREKALL    911 - 980
YYCEALTKTNLQLQKAACLALKILEATESIKMLVTLCQSDTEEIRNVASETLLSLGEDGRLAYEQLDKFP    981 - 1050
RDCVKVGGRHGTEVATAF                                                       1051 - 1068
//

Text Mined References (23)

PMID Year Title