Property Summary

NCBI Gene PubMed Count 26
PubMed Score 89.67
PubTator Score 28.64

Knowledge Summary

Patent (14,331)

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.113 1.1e-03
cystic fibrosis -1.020 2.4e-04
atypical teratoid/rhabdoid tumor 1.300 1.3e-04
non-small cell lung cancer 1.011 2.7e-08
intraductal papillary-mucinous neoplasm ... 1.400 2.8e-03
interstitial cystitis -2.700 1.1e-04
Breast cancer -2.000 2.9e-11
spina bifida -1.614 4.9e-02
ovarian cancer 1.100 5.3e-03
pituitary cancer -2.400 1.8e-06
chronic rhinosinusitis -1.272 4.4e-02

Gene RIF (16)

PMID Text
26129644 CHAND and Bartsocas-Papas syndrome might be allelic disorders or RIPK4 mutations could confer varying degrees of phenotypic severity, depending on their localization within or outside functionally important domains.
25784454 The p.Ser376X mutation in RIPK4 impaired its induction of IRF6 transactivator function.
25285922 The protein kinase C-associated kinase (PKK), which is also known as the receptor-interacting protein kinase 4, is a suppressor of tumor growth in squamous cell carcinoma of the skin.
25246526 Ser-413 and Ser-424 in IRF6 are important for its activation by RIPK4
25134534 we identified an epithelial ovarian cancer susceptibility loci at 10p11.21 (rs1192691 near ANKRD30A, P(meta) = 2.62 x 10(-8))
25096806 Suppression of PKK expression by RNA interference inhibits phosphorylation of IKKalpha and IKKbeta as well as activation of NF-kappaB in human cancer cell lines; thus, PKK regulates NF-kappaB activation by modulating activation of IKKalpha and IKKbeta.
24519546 Authors found a correlation between RIPK4 expression and TSCC degree of differentiation, age, and gender.
24413083 Data indicate protein-serine-threonine kinases RIPK4 overexpression in transformed fetal hepatocytes.
23371553 phosphorylation of DVL2 by RIPK4 favored canonical Wnt signaling; findings suggest that RIPK4 overexpression may contribute to the growth of certain tumor types
22197488 The present study's findings show that recessive mutations in RIPK4 cause Bartsocas-Papas syndrome and its variant, the autosomal-recessive form of multiple pterygium syndrome (Aslan type).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19818768 Data indicate that rip4 gene expression is regulated in a complex manner, which might have therapeutic implications.
18511573 Phosphorylation of protein kinase C delta is associated with activation of vascular endothelial growth factor and soluble fms-like tyrosine kinase-1 receptor in lipopolysaccharide induced macrophages
18025152 PKK plays a pivotal role in the survival of human Diffuse large B-cell lymphoma (DLBCL) cells and represents a potential target for DLBCL therapy
17039240 NF-kappaB activity and keratinocyte differentiation are regulated by the RIP4 protein, which has roles in cutaneous wound repair
12676934 PKK may function in both a kinase-dependent as well as a kinase-independent manner to activate NFkappaB

AA Sequence

MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEA      1 - 70
KKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLL     71 - 140
HLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFA    141 - 210
IVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNG    211 - 280
LNGELIRQVLAALLPVTGRWRSPGEGFRLESEVIIRVTCPLSSPQEITSETEDLCEKPDDEVKETAHDLD    281 - 350
VKSPPEPRSEVVPARLKRASAPTFDNDYSLSELLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLS    351 - 420
GVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALDSGASLL    421 - 490
HLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAA    491 - 560
QNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGH    561 - 630
LPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTST    631 - 700
ARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEEL    701 - 770
VSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT            771 - 832
//

Text Mined References (28)

PMID Year Title
26972000 2016 Substrate-Trapped Interactors of PHD3 and FIH Cluster in Distinct Signaling Pathways.
26129644 2015 Identification of a novel mutation in RIPK4 in a kindred with phenotypic features of Bartsocas-Papas and CHAND syndromes.
25784454 2015 Disease-associated mutations in IRF6 and RIPK4 dysregulate their signalling functions.
25285922 2015 PKK suppresses tumor growth and is decreased in squamous cell carcinoma of the skin.
25246526 2014 Receptor-interacting protein kinase 4 and interferon regulatory factor 6 function as a signaling axis to regulate keratinocyte differentiation.
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
25096806 2014 Protein kinase C-associated kinase regulates NF-?B activation through inducing IKK activation.
24519546 2014 RIPK4 is downregulated in poorly differentiated tongue cancer and is associated with migration/invasion and cisplatin-induced apoptosis.
24413083 2015 Retroviral insertional mutagenesis in telomerase-immortalized hepatocytes identifies RIPK4 as novel tumor suppressor in human hepatocarcinogenesis.
23371553 2013 Phosphorylation of Dishevelled by protein kinase RIPK4 regulates Wnt signaling.
22197489 2012 Mutations in RIPK4 cause the autosomal-recessive form of popliteal pterygium syndrome.
22197488 2012 Exome sequence identifies RIPK4 as the Bartsocas-Papas syndrome locus.
21931591 2011 cIAP1/2 are direct E3 ligases conjugating diverse types of ubiquitin chains to receptor interacting proteins kinases 1 to 4 (RIP1-4).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19818768 2010 RIP4 is a target of multiple signal transduction pathways in keratinocytes: implications for epidermal differentiation and cutaneous wound repair.
18511573 2008 Novel PKC signaling is required for LPS-induced soluble Flt-1 expression in macrophages.
18025152 2008 Protein kinase C-associated kinase is required for NF-kappaB signaling and survival in diffuse large B-cell lymphoma cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17039240 2007 Regulation of NF-kappaB activity and keratinocyte differentiation by the RIP4 protein: implications for cutaneous wound repair.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12676934 2003 Protein kinase C-associated kinase can activate NFkappaB in both a kinase-dependent and a kinase-independent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446564 2002 RIP4 (DIK/PKK), a novel member of the RIP kinase family, activates NF-kappa B and is processed during apoptosis.
11278382 2001 Protein kinase C-associated kinase (PKK), a novel membrane-associated, ankyrin repeat-containing protein kinase.
10948194 2000 DIK, a novel protein kinase that interacts with protein kinase Cdelta. Cloning, characterization, and gene analysis.
10830953 2000 The DNA sequence of human chromosome 21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.