Property Summary

NCBI Gene PubMed Count 194
PubMed Score 169.39
PubTator Score 481.92

Knowledge Summary

Patent (20,387)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 3.623 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 8.8e-10
atypical teratoid / rhabdoid tumor 1.500 4.6e-06
glioblastoma 1.500 2.5e-04
lung cancer -1.400 8.2e-04
pediatric high grade glioma 1.100 2.8e-04
pilocytic astrocytoma 1.100 5.3e-06
ovarian cancer 1.600 3.3e-07

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (120)

PMID Text
27493188 By promoting both inflammation and cell death, RIPK1 may be a common mediator of axonal pathology in amyotrophic lateral sclerosis.
26575016 Report role of RIP1 in Smac mimetic mediated chemosensitization of neuroblastoma cells.
26460489 Down-regulating RIP1 promotes oxaliplatin induced Tca8113 cells apoptosis
26313915 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26297639 RIPK1 and RIPK2 are targets of HIV-1 Protease activity during infection, and their inactivation may contribute to modulation of cell death and host defense pathways by HIV-1
26297639 PR cleavage of RIPK1 disrupts RIPK1 function
26195820 cFLIP-mediated and caspase-8-dependent limited cleavage of RIP1 is a new layer of mechanism that promotes NF-KB activation and lymphoma survival.
26086143 Studies indicate that RIP kinases RIPK1 and RIPK3 directly regulate inflammatory signaling.
26018731 These results identify upregulation of RIPK1 as an important resistance mechanism of melanoma cells to tunicamycin- or thapsigargin-induced endoplasmic reticulum stress.
25939870 ZFP36 controls RIP1 levels in glioma neural stem cell lines.
25910754 Data suggest that TP63 (tumor protein p63) and microRNA-101 are involved in regulation of necroptosis in squamous cell carcinoma (SCC); here, modulation of RIPK1 with miR-101-3p mimic/inhibitor affects sensitivity of SCC cells to cisplatin.
25908842 RIP1 represses basal autophagy in part due to its ability to regulate the TFEB transcription factor;RIP1 activates ERK, which negatively regulates TFEB though phosphorylation of serine 142
25880091 In contrast, both necrostatin-1, a RIP1 kinase inhibitor, and Enbrel, a TNFalpha-blocking antibody, do not interfere with BV6/Drozitumab-induced apoptosis, demonstrating that apoptosis occurs independently of RIP1 kinase activity or an autocrine TNFalpha loop.
25817730 results indicate that a TNFR1/RIPK1/P38 axis is present in adenosine-induced apoptosis of colonic cancer cells. This axis triggers apoptosis and plays crucial roles in relay of the death signaling
25766324 a novel non-enzymatic function of AChE-R is to stimulate RIPK1/MLKL-dependent regulated necrosis (necroptosis). The latter complements a cholinergic system in the ovary, which determines life and death of ovarian cells.
25754842 Data show that toll-like receptor 3/TRIF protein signalling regulates cytokines IL-32 and IFN-beta secretion by activation of receptor-interacting protein-1 (RIP-1) and tumour necrosis factor receptor-associated factor 6 (TRAF6) in cornea epithelial cells.
25724678 RIP1 is an oncogenic driver in melanoma, which leads to potential targeting of its NF-kappaB-dependent activation mechanism as a novel approach to treat this disease.
25697054 in the absence of caspase-8 activity, 24(S)-Hydroxycholesterol induces a necroptosis-like cell death which is RIPK1-dependent but MLKL-independent.
25674983 Herpes simplex virus 1- and 2 ICP6 and ICP10 proteins prevent necroptosis in human cells by inhibiting the interaction between receptor-interacting protein kinase 1 (RIP1) and RIP3, a key step in tumor necrosis factor (TNF)-induced necroptosis.
25583602 These data demonstrate that RIP1 is essential for the regulation of death receptor mediated autophagy and apoptosis.
25575821 Data suggest that neoalbaconol-induced necroptosis include receptor interacting serine/threonine kinase 1-dependent expression of tumor necrosis factor alpha and receptor interacting serine/threonine kinase 3-dependent generation of reactive oxygen species.
25476903 RIPK1 indirectly regulates caspase-8 activation, in part via interaction with the ER stress sensor IRE1.
25459879 Receptor Interacting Protein Kinase-1 (RIPK1), a key player in inflammation and cell death. [Review]
25326752 our results reveal a specific role for the RIP1-RIP3-DRP1 pathway in RNA virus-induced activation of the NLRP3 inflammasome
25277242 A reduction in the expression of RIP-1 in gallbladder cancer cells can exert inhibitory effects on the ability of cells to grow and invade in vitro.
25096578 mitochondrial reactive oxygen species generator 2,3-dimethoxy-1,4-naphthoquinone elicits necrosis characterized by the involvement of RIP1 and Drp1.
24980648 In this study,dual ensemble screening, a novel computational strategy was used to identify diverse and potent inhibitors against RIPK1
24902904 RIPK1 can activate RIPK3 in response to receptor signaling, but also acts as a negative regulator of spontaneous RIPK3 activation in the cytosol.
24832602 beta-lapachone induces programmed necrosis through the NQO1-dependent ROS-mediated RIP1-PARP1-AIF pathway.
24821786 RIP1 suppresses innate immune necrotic as well as apoptotic cell death during mammalian parturition.
24762656 The mechanism by which FLIP nitrosylation regulates NF-kappaB activity involves RIP1 binding and redistribution, whereas TRAF2 binding and distribution are unaffected.
24583643 Maintenance of glycolysis by RIP1 is pivotal to cancer cell energy homeostasis and DNA integrity.
24425875 a chemoresistant role for RIP1 that maintains inhibitor of apoptosis protein (IAP) expression by release of microRNA-146a-mediated catalase suppression, where intervention within this pathway may be exploited for chemosensitization.
24398693 the C-terminal domain of c-FLIPL specifically inhibits the interaction of the caspase 8 prodomain with the RIP1 death domain and, thereby, regulates caspase 8-dependent NF-kappaB activation.
24361886 structure-based mutations of TNFR-1 (P367A and P368A), TRADD (F266A), and RIP1 (M637A and R638A) disrupted formation of the death domain (DD) complex and prevented stable interactions among those DDs
24314238 The protein levels of crucial modulators of necroptosis, RIP1 and RIP3, are increased by shikonin treatment in primary tumor tissues.
24079414 This review focuses on the functional roles of RIP1 in regulating multiple cellular mechanisms--{REVIEW}
24059293 an alanine residue substitution for Ser(89) enhanced RIP1 kinase activity and TNF-induced programmed necrosis without affecting RIP1-RIP3 necrosome formation.
23840441 Shikonin mediated necroptosis in glioma cells is associated with the up-regulated expression of RIP-1 and oxidative stress.
23770847 our study implicates RIP1 ubiquitination as a critical component of API2-MALT1-dependent lymphomagenesis
23545938 crucial mediator of CD30-induced cell death in anaplastic large-cell lymphoma cells
23313255 Data suggest that USP4 (ubiquitin specific peptidase 4) down-regulates RIP1-mediated TNF-alpha (tumor necrosis factor-alpha) activation and promotes TNF-alpha-induced apoptosis via deubiquitination of RIP1 in head/neck squamous cell carcinoma.
23071110 procaspase-8 activity is essential for cell survival by inhibiting both apoptotic and nonapoptotic cell death dependent on receptor-interacting protein kinase 1 (RIP1) and RIP3
23051914 These results reveal a critical role for the MAPK8 activation pathway through TRAF2 and RIPK1 for TNFSF10-induced autophagy that blunts apoptosis in cancer cells.
22927431 IAP inhibitors and lexatumumab synergistically trigger apoptosis in a RIP1-dependent but TNFalpha-independent manner in RMS cells
22922561 Formation of the death domain complex between FADD and RIP1 proteins in vitro
22891283 RIP is required for cell culture supernatant-induced apoptosis, but not for classical Fas-mediated apoptosis.
22858542 Results demonstrate that in the absence of caspase 6 activity, intrinsic triggers of apoptosis induce the receptor-interacting-kinase-1-dependent production of pro-inflammatory cytokines.
22848449 recruitment of NEMO to ubiquitinated RIP1 is a key step in the TNFR1 signaling pathway that determines whether RIP1 triggers a necrotic death response.
22837689 The mechanism by which Nec-1 sensitizes shikonin-induced apoptosis appears to be the inhibition of RIP1 kinase-dependent phosphorylation of ERK1/2.
22817896 Study shows that RIP1 and RIP3 form an amyloid structure through their RIP homotypic interaction motifs and that this heterodimeric amyloid structure is a functional signaling complex that mediates programmed necrosis.
22685397 we demonstrate that Porphyromonas gingivalis infection of human aortic endothelial cells resulted in the rapid cleavage of RIPK1 and RIPK2
22674009 Receptor-interacting protein (RIP) and Sirtuin-3 (SIRT3) are on opposite sides of anoikis and tumorigenesis.
22659130 USP2 isoforms can control the ubiquitination status of many proteins but from a panel of potential targets only the protein level of RIP1 was increased.
22580278 These data indicate that the interaction between ARD1 and RIP1 plays an important role in the DNA damage-induced NF-kappaB activation, and that the acetyltransferase activity of ARD1 and its localization in to the nucleus are involved in such stress response.
22362767 Intermediate domain of receptor-interacting protein kinase 1 (RIPK1) determines switch between necroptosis and RIPK1 kinase-dependent apoptosis
22179575 De-ubiquitinating protease USP2a targets RIP1 and TRAF2 to mediate cell death by TNF.
22173242 findings provide first evidence that IAP inhibitors present a promising strategy to prime childhood ALL cells for chemotherapy-induced apoptosis in a RIP1-dependent manner
21613257 we demonstrate that the immune specific cell surface molecule Toso exhibits antiapoptotic effects on death receptor signaling by a novel regulatory mechanism involving the adaptor kinase RIP1
21606198 Data show that DNA damage stimulates the formation of a cytosolic complex of ATM, NEMO, RIP1, and TAK1, and that TAK1 mediates the NF-kappaB and p38 mitogen-activated protein kinase (MAPK)/MAPK-activated protein 2 responses to DNA damage.
21576359 Data demonstrate that NF-kappaB protects cells from IFN-gamma/RIP1-mediated necroptosis by transcriptionally activating a survival response that quenches ROS to preserve mitochondrial integrity.
21525013 TWEAK induces apoptosis through a death-signaling complex comprising receptor-interacting protein 1 (RIP1), Fas-associated death domain (FADD), and caspase-8
21460625 C42 enhances the cellular autophagic process, which requires both PARP and RIP-1 participation, preceding and possibly augmenting, the caspase-dependent apoptotic cell death
21458669 Extensive DNA lesions stimulated 2 sequential NF-kappaB activation phases, requiring ATM and NEMO/IKK-gamma: first TNF-alpha-TNFR1 feedforward signaling, promoting the second phase and driving RIP1 phosphorylation.
21419663 Conjugation of ubiquitin chains to RIP1 facilitated assembly of the RIG-I complex, resulting in enhanced phosphorylation of IRF3
21383699 ANXA1 can constitutively activate NF-kappaB in breast cancer cells through the interaction with the IKK complex
21282461 The death domain kinase RIP1 links the immunoregulatory CD40 receptor to apoptotic signaling in carcinomas
21266470 TNFalpha-duced NF-kappaB activation is attenuated by RIP1 through stabilization of TRAF2.
21148036 RIP1-dependent caspase activation contributes to polyinosinic-polycytidylic acid-induced soluble tumor necrosis factor receptor 1 (TNFR1) shedding indicative of innate immune responses to viral infections in human airway epithelial (NCI-H292) cells.
21113135 The authors demonstrate that c-IAP1 and UbcH5 family promote K11-linked polyubiquitination of receptor-interacting protein 1 (RIP1) in vitro and in vivo.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20825417 Results indicate an important role of RIP1 in apoptosis induced by combined treatment with TNFalpha and MeBS.
20805296 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20801175 PR cleavage of RIPK1 disrupts RIPK1 function
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20567846 The RIPK1 and CASP7 polymorphisms can be considered as possible prognostic markers for survival after curative resection in patients with colorectal cancer.
20567846 Observational study of gene-disease association. (HuGE Navigator)
20550618 Data show that miR-155 can inhibit necrosis and improve cell survival by repressing the receptor interacting protein1, RIP1, without affecting cardiomyogenic differentiation potential.
20354226 RIP1 and RIP3 have roles in TNF-induced necrosis
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910467 USP21 plays an important role in the down-regulation of TNFalpha-induced NF-kappaB activation through deubiquitinating RIP1.
19890662 Observational study of gene-disease association. (HuGE Navigator)
19778795 Both RIP and caspase-8 may play important roles in the occurrence and progression of oral squamous cell carcinoma and oral precancerous lesions.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19641134 RIP1 is necessary for the most efficient activation of downstream caspases by Fas when treated with membrane-bound Fas ligand, but not with agonistic antibodies or cross-linked soluble Fas ligand.
19632771 RIP1 is important in maintaining resistance to TRAIL-induced apoptosis in breast tumor cells and highlight the potential therapeutic benefit of the combination of Hsp90 inhibitors and TRAIL against breast tumor cells.
19629486 Data show that the polymorphisms of LTA (rs1041981) and RIPK1 (rs2272990) may correlate with TTP in patients with DLBCL treated with R-CHOP.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19336552 Observational study of gene-disease association. (HuGE Navigator)
19219602 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19151112 glomerular and tubular expression of TNF-alpha, (TNF receptor-associated death domain protein)TRADD, RIP(receptor-interacting protein) and TRAF-2 (TNF receptor-associated factor-) was significantly up-regulated in Lupus nephritis
18990758 Observational study of gene-disease association. (HuGE Navigator)
18941233 Induction of NF-kappa B depends upon the adaptor receptor-interacting protein kinase (RIP)1, acting via a RIP homotypic interaction motif-dependent interaction with DNA-dependent activator of IFN regulatory factors (DAI).
18813792 the simultaneous downregulation of uPAR and MMP-9 induces apoptosome-mediated apoptosis through FADD-associated protein RIP and caspase 9
18635966 The protein encoded by the hybrid transcript lacks the putative kinase domain of RIP1, but potently stimulates NFkappaB, AP-1 and Ets-1 activity.
18621737 c-IAP1 and c-IAP2 are required for TNFalpha-stimulated RIP1 ubiquitination and NF-kappaB activation.
18570872 cIAP1 and cIAP2 promote cancer cell survival by functioning as E3 ubiquitin ligases that maintain constitutive ubiquitination of the RIP1 adaptor protein.
18450748 activation and formation of TICAM-1 signalosomes with NF-kappaB and interferon regulatory factor-3 requires oligomerization induced at two different sites and RIP1 binding
18442983 cytomegalovirus M45 protein provides a direct cell type-dependent replication benefit to the virus while modulating other biological processes signaling via the RIP1 adaptor such as activation of Toll-like receptor (TLR)3 and other mediators of cell death
18178551 Cezanne forms a novel negative feedback loop in pro-inflammatory signaling and that it suppresses NF-kappaB activation by targeting RIP1 signaling intermediaries for deubiquitination
18067272 Data demonstrated that CK1alpha interacted with and phosphorylated RIP1 at the intermediate domain. Finally, we showed that CK1alpha enhanced RIP1-mediated NF-kappaB activation.
17996648 In response to autocrine TNFalpha signaling, the Smac mimetic promotes formation of a RIPK1-dependent caspase-8-activating complex, leading to apoptosis
17951993 These results suggested that HPB-ALL cells have a caspase-independent RIP kinasedependent pathway for Fas ligation.
17638906 RIP and c-FLIP-mediated assembly of the death-inducing signaling complex in nonrafts is a critical upstream event in TRAIL resistance
17448597 TNFRSF is upregulated after radical prostatectomy for prostatic neoplasms.
17389591 TNF-induced TRAF2-RIP1-AIP1-ASK1 complex formation and for the activation of ASK1-JNK/p38 apoptotic signaling.
17306544 findings show ubiquitination of RIP1 inhibits TNF-induced apoptosis first through an NF-kappaB-independent mechanism, then through an NF-kappaB-dependent mechanism; in absence of ubiquitination, RIP1 serves as a proapoptotic signaling molecule
17301840 We describe how RIP1 acts as a key integrator of signalling pathways initiated by stimulation of death receptors, bacterial or viral infection, genotoxic stress and T-cell homeostasis.
17296724 RIP may serve as a general activator of IRF7, responding to and transmitting the signals from various stimuli, and that ubiquitination may be a general mechanism for enhancing the activity of IRF7.
17235653 The expression of receptor-interacting protein 1 (RIP1) in peripheral blood mononuclear cells was significantly decreased in SLE patients.
16825191 RIP is one of the critical components involved in mediating DNA damage-induced, p53-independent cell death
16611992 TRADD and RIP1 compete for recruitment to the TNFR1 signaling complex and the distinct programs of cell death.
16603398 Activation of IKK by TNF-alpha requires site-specific ubiquitination of RIP1.
16543241 This study provides the first genetic evidence that the ubiquitination of RIP is required for TNFalpha-induced NF-kappaB activation.
16260783 TAK1 is recruited to the TNF-R1 complex via RIP and likely cooperates with MEKK3 to activate NF-kappaB in TNF-alpha signaling
15572679 RIP-dependent recruitment of MEKK3 plays a specific role in TNF-alpha signaling.
15121855 FAK overexpression in human tumors provides a survival signal function by binding to RIP and inhibiting its interaction with the death receptor complex.
14532286 cells pre-stimulated through TNFR-2 prior to subsequent activation of TNFR-1, showed enhanced cell death and recruitment of RIP to the TNFR-1 complex; deficiency of RIP rescued the infected cells from TNF-induced cytotoxicity

AA Sequence

MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRL      1 - 70
RHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLK     71 - 140
PENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSD    141 - 210
VYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPG    211 - 280
IEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG    281 - 350
MGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF    351 - 420
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY    421 - 490
RPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDST    491 - 560
NTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQ    561 - 630
MLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN                                 631 - 671
//

Text Mined References (203)

PMID Year Title
27493188 2016 RIPK1 mediates axonal degeneration by promoting inflammation and necroptosis in ALS.
26575016 2015 Differential role of RIP1 in Smac mimetic-mediated chemosensitization of neuroblastoma cells.
26559832 2015 Herpes Simplex Virus 1 (HSV-1) and HSV-2 Mediate Species-Specific Modulations of Programmed Necrosis through the Viral Ribonucleotide Reductase Large Subunit R1.
26460489 2015 Down-Regulating Receptor Interacting Protein Kinase 1 (RIP1) Promotes Oxaliplatin-Induced Tca8113 Cell Apoptosis.
26313915 2015 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26297639 2015 HIV-1 protease cleaves the serine-threonine kinases RIPK1 and RIPK2.
26195820 2015 RIP1 Cleavage in the Kinase Domain Regulates TRAIL-Induced NF-?B Activation and Lymphoma Survival.
26086143 2015 The diverse role of RIP kinases in necroptosis and inflammation.
26018731 2015 RIPK1 regulates survival of human melanoma cells upon endoplasmic reticulum stress through autophagy.
25939870 2015 ZFP36 stabilizes RIP1 via degradation of XIAP and cIAP2 thereby promoting ripoptosome assembly.
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25910754 2015 Phospho-?Np63?-responsive microRNAs contribute to the regulation of necroptosis in squamous cell carcinoma upon cisplatin exposure.
25908842 2015 RIP1 negatively regulates basal autophagic flux through TFEB to control sensitivity to apoptosis.
25880091 2015 Identification of RIP1 as a critical mediator of Smac mimetic-mediated sensitization of glioblastoma cells for Drozitumab-induced apoptosis.
25817730 2015 Adenosine induces apoptosis through TNFR1/RIPK1/P38 axis in colon cancer cells.
25766324 2015 Readthrough acetylcholinesterase (AChE-R) and regulated necrosis: pharmacological targets for the regulation of ovarian functions?
25754842 2015 TLR3/TRIF signalling pathway regulates IL-32 and IFN-? secretion through activation of RIP-1 and TRAF in the human cornea.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
25724678 2015 RIP1 Kinase Is an Oncogenic Driver in Melanoma.
25697054 2015 24(S)-Hydroxycholesterol induces RIPK1-dependent but MLKL-independent cell death in the absence of caspase-8.
25674983 2015 Herpes simplex virus suppresses necroptosis in human cells.
25583602 2015 RIP1 modulates death receptor mediated apoptosis and autophagy in macrophages.
25575821 2015 Neoalbaconol induces cell death through necroptosis by regulating RIPK-dependent autocrine TNF? and ROS production.
25476903 2014 RIPK1 promotes death receptor-independent caspase-8-mediated apoptosis under unresolved ER stress conditions.
25459879 2014 The two faces of receptor interacting protein kinase-1.
25416956 2014 A proteome-scale map of the human interactome network.
25402006 2015 In silico prediction of physical protein interactions and characterization of interactome orphans.
25326752 2014 RNA viruses promote activation of the NLRP3 inflammasome through a RIP1-RIP3-DRP1 signaling pathway.
25277242 2014 Expression of the RIP-1 gene and its role in growth and invasion of human gallbladder carcinoma.
25096578 2014 A receptor-interacting protein 1 (RIP1)-independent necrotic death under the control of protein phosphatase PP2A that involves the reorganization of actin cytoskeleton and the action of cofilin-1.
24980648 2014 Ensemble pharmacophore meets ensemble docking: a novel screening strategy for the identification of RIPK1 inhibitors.
24902904 2014 RIPK1 both positively and negatively regulates RIPK3 oligomerization and necroptosis.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24832602 2014 ?-Lapachone induces programmed necrosis through the RIP1-PARP-AIF-dependent pathway in human hepatocellular carcinoma SK-Hep1 cells.
24821786 2014 RIP1 suppresses innate immune necrotic as well as apoptotic cell death during mammalian parturition.
24762656 2014 S-nitrosylation of FLICE inhibitory protein determines its interaction with RIP1 and activation of NF-?B.
24583643 2014 RIP1 maintains DNA integrity and cell proliferation by regulating PGC-1?-mediated mitochondrial oxidative phosphorylation and glycolysis.
24425875 2014 Receptor-interacting protein 1 increases chemoresistance by maintaining inhibitor of apoptosis protein levels and reducing reactive oxygen species through a microRNA-146a-mediated catalase pathway.
24398693 2014 The C-terminal domain of the long form of cellular FLICE-inhibitory protein (c-FLIPL) inhibits the interaction of the caspase 8 prodomain with the receptor-interacting protein 1 (RIP1) death domain and regulates caspase 8-dependent nuclear factor ?B (NF-?B) activation.
24361886 2014 Death domain complex of the TNFR-1, TRADD, and RIP1 proteins for death-inducing signaling.
24314238 2013 The anti-tumor effect of shikonin on osteosarcoma by inducing RIP1 and RIP3 dependent necroptosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24079414 2014 Control of life-or-death decisions by RIP1 kinase.
24059293 2013 Positive and negative phosphorylation regulates RIP1- and RIP3-induced programmed necrosis.
23840441 2013 Shikonin kills glioma cells through necroptosis mediated by RIP-1.
23770847 2014 The API2-MALT1 fusion exploits TNFR pathway-associated RIP1 ubiquitination to promote oncogenic NF-?B signaling.
23545938 2013 RIP1 expression is necessary for CD30-mediated cell death induction in anaplastic large-cell lymphoma cells.
23473668 2013 Structural basis of RIP1 inhibition by necrostatins.
23313255 2013 Ubiquitin-specific protease 4 promotes TNF-?-induced apoptosis by deubiquitination of RIP1 in head and neck squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23104095 2012 Immunodeficiency, autoinflammation and amylopectinosis in humans with inherited HOIL-1 and LUBAC deficiency.
23071110 2012 Protease activity of procaspase-8 is essential for cell survival by inhibiting both apoptotic and nonapoptotic cell death dependent on receptor-interacting protein kinase 1 (RIP1) and RIP3.
23051914 2012 Attenuation of TNFSF10/TRAIL-induced apoptosis by an autophagic survival pathway involving TRAF2- and RIPK1/RIP1-mediated MAPK8/JNK activation.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22927431 2012 RIP1 protein-dependent assembly of a cytosolic cell death complex is required for inhibitor of apoptosis (IAP) inhibitor-mediated sensitization to lexatumumab-induced apoptosis.
22922561 2013 Formation of the death domain complex between FADD and RIP1 proteins in vitro.
22891283 2012 Vesicles released by activated T cells induce both Fas-mediated RIP-dependent apoptotic and Fas-independent nonapoptotic cell deaths.
22858542 2013 Intrinsic cleavage of receptor-interacting protein kinase-1 by caspase-6.
22848449 2012 NEMO inhibits programmed necrosis in an NF?B-independent manner by restraining RIP1.
22837689 2012 Nec-1 enhances shikonin-induced apoptosis in leukemia cells by inhibition of RIP-1 and ERK1/2.
22817896 2012 The RIP1/RIP3 necrosome forms a functional amyloid signaling complex required for programmed necrosis.
22685397 2012 Pathogen-mediated proteolysis of the cell death regulator RIPK1 and the host defense modulator RIPK2 in human aortic endothelial cells.
22674009 2012 Receptor-interacting protein (RIP) and Sirtuin-3 (SIRT3) are on opposite sides of anoikis and tumorigenesis.
22659130 2012 De-ubiquitinating proteases USP2a and USP2c cause apoptosis by stabilising RIP1.
22580278 2012 ARD1 binding to RIP1 mediates doxorubicin-induced NF-?B activation.
22362767 2012 Intermediate domain of receptor-interacting protein kinase 1 (RIPK1) determines switch between necroptosis and RIPK1 kinase-dependent apoptosis.
22274400 2012 Pick your poison: the Ripoptosome, a cell death platform regulating apoptosis and necroptosis.
22265414 2012 The mitochondrial phosphatase PGAM5 functions at the convergence point of multiple necrotic death pathways.
22265413 2012 Mixed lineage kinase domain-like protein mediates necrosis signaling downstream of RIP3 kinase.
22179575 2012 De-ubiquitinating protease USP2a targets RIP1 and TRAF2 to mediate cell death by TNF.
22173242 2012 RIP1 is required for IAP inhibitor-mediated sensitization of childhood acute leukemia cells to chemotherapy-induced apoptosis.
22028622 2011 Smac mimetic bypasses apoptosis resistance in FADD- or caspase-8-deficient cells by priming for tumor necrosis factor ?-induced necroptosis.
21931591 2011 cIAP1/2 are direct E3 ligases conjugating diverse types of ubiquitin chains to receptor interacting proteins kinases 1 to 4 (RIP1-4).
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21887730 2012 Control of NOD2 and Rip2-dependent innate immune activation by GEF-H1.
21810480 2011 AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling.
21737330 2011 cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.
21613257 2011 Toso regulates the balance between apoptotic and nonapoptotic death receptor signaling by facilitating RIP1 ubiquitination.
21606198 2011 A cytosolic ATM/NEMO/RIP1 complex recruits TAK1 to mediate the NF-kappaB and p38 mitogen-activated protein kinase (MAPK)/MAPK-activated protein 2 responses to DNA damage.
21576359 2011 NF-kappaB protects cells from gamma interferon-induced RIP1-dependent necroptosis.
21525013 2011 TWEAK induces apoptosis through a death-signaling complex comprising receptor-interacting protein 1 (RIP1), Fas-associated death domain (FADD), and caspase-8.
21460625 2011 PARP and RIP 1 are required for autophagy induced by 11'-deoxyverticillin A, which precedes caspase-dependent apoptosis.
21458669 2011 NEMO and RIP1 control cell fate in response to extensive DNA damage via TNF-? feedforward signaling.
21455173 2011 Linear ubiquitination prevents inflammation and regulates immune signalling.
21419663 2011 RIG-I RNA helicase activation of IRF3 transcription factor is negatively regulated by caspase-8-mediated cleavage of the RIP1 protein.
21383699 2011 Annexin-1 interacts with NEMO and RIP1 to constitutively activate IKK complex and NF-?B: implication in breast cancer metastasis.
21282461 2011 The death domain kinase RIP1 links the immunoregulatory CD40 receptor to apoptotic signaling in carcinomas.
21269460 2011 Initial characterization of the human central proteome.
21266470 2011 TNF? induced noncanonical NF-?B activation is attenuated by RIP1 through stabilization of TRAF2.
21148036 2011 Double-stranded RNA induces shedding of the 34-kDa soluble TNFR1 from human airway epithelial cells via TLR3-TRIF-RIP1-dependent signaling: roles for dual oxidase 2- and caspase-dependent pathways.
21113135 2010 c-IAP1 and UbcH5 promote K11-linked polyubiquitination of RIP1 in TNF signalling.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20825417 2010 Modulation of RIP1 ubiquitylation and distribution by MeBS to sensitize cancer cells to tumor necrosis factor ?-induced apoptosis.
20805296 2011 Genetic variants within the MAP kinase signalling network and anti-TNF treatment response in rheumatoid arthritis patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20567846 2011 RIPK1 and CASP7 polymorphism as prognostic markers for survival in patients with colorectal cancer after complete resection.
20550618 2011 MicroRNA-155 prevents necrotic cell death in human cardiomyocyte progenitor cells via targeting RIP1.
20413098 2010 Virus inhibition of RIP3-dependent necrosis.
20354226 2010 The role of the kinases RIP1 and RIP3 in TNF-induced necrosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910467 2010 Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.
19890662 2010 TNF superfamily gene polymorphism as prognostic factor in early breast cancer.
19781631 2010 Proteinase-activated receptor-2 mediated inhibition of TNFalpha-stimulated JNK activation - A novel paradigm for G(q/11) linked GPCRs.
19778795 2009 [Expressions of receptor-interacting protein and caspase-8 in oral squamous cell carcinoma and oral precancerous lesions].
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19641134 2009 Membrane-bound Fas ligand requires RIP1 for efficient activation of caspase-8 within the death-inducing signaling complex.
19632771 2010 Down-regulation of RIP expression by 17-dimethylaminoethylamino-17-demethoxygeldanamycin promotes TRAIL-induced apoptosis in breast tumor cells.
19629486 2010 Lymphotoxin alfa and receptor-interacting protein kinase 1 gene polymorphisms may correlate with prognosis in patients with diffuse large B cell lymphoma treated with R-CHOP.
19590578 2009 DAI/ZBP1 recruits RIP1 and RIP3 through RIP homotypic interaction motifs to activate NF-kappaB.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19524513 2009 Phosphorylation-driven assembly of the RIP1-RIP3 complex regulates programmed necrosis and virus-induced inflammation.
19524512 2009 Receptor interacting protein kinase-3 determines cellular necrotic response to TNF-alpha.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19336552 2009 Risk of non-Hodgkin lymphoma associated with germline variation in genes that regulate the cell cycle, apoptosis, and lymphocyte development.
19219602 2009 Prostaglandin synthase 2/cyclooxygenase 2 (PTGS2/COX2) 8473T>C polymorphism associated with prognosis for patients with colorectal cancer treated with capecitabine and oxaliplatin.
19151112 2009 Up-regulated renal expression of TNF-alpha signalling adapter proteins in lupus glomerulonephritis.
18990758 2008 Genetic variation in tumor necrosis factor and the nuclear factor-kappaB canonical pathway and risk of non-Hodgkin's lymphoma.
18941233 2008 Receptor-interacting protein homotypic interaction motif-dependent control of NF-kappa B activation via the DNA-dependent activator of IFN regulatory factors.
18813792 2008 Simultaneous downregulation of uPAR and MMP-9 induces overexpression of the FADD-associated protein RIP and activates caspase 9-mediated apoptosis in gliomas.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18635966 2008 Transposon-based mutagenesis identifies short RIP1 as an activator of NFkappaB.
18621737 2008 c-IAP1 and c-IAP2 are critical mediators of tumor necrosis factor alpha (TNFalpha)-induced NF-kappaB activation.
18570872 2008 cIAP1 and cIAP2 facilitate cancer cell survival by functioning as E3 ligases that promote RIP1 ubiquitination.
18485876 2008 TNF-alpha induces two distinct caspase-8 activation pathways.
18450748 2008 Homo-oligomerization is essential for Toll/interleukin-1 receptor domain-containing adaptor molecule-1-mediated NF-kappaB and interferon regulatory factor-3 activation.
18450452 2008 CARP-2 is an endosome-associated ubiquitin ligase for RIP and regulates TNF-induced NF-kappaB activation.
18442983 2008 Cytomegalovirus M45 cell death suppression requires receptor-interacting protein (RIP) homotypic interaction motif (RHIM)-dependent interaction with RIP1.
18408713 2008 Identification of RIP1 kinase as a specific cellular target of necrostatins.
18178551 2008 NF-kappaB suppression by the deubiquitinating enzyme Cezanne: a novel negative feedback loop in pro-inflammatory signaling.
18067272 2008 Casein kinase 1alpha interacts with RIP1 and regulates NF-kappaB activation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18029035 2008 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain.
18022363 2007 IAP antagonists target cIAP1 to induce TNFalpha-dependent apoptosis.
17996648 2007 Autocrine TNFalpha signaling renders human cancer cells susceptible to Smac-mimetic-induced apoptosis.
17979836 2007 From death receptor to reactive oxygen species and c-Jun N-terminal protein kinase: the receptor-interacting protein 1 odyssey.
17951993 2007 Caspase-independent cell death by Fas ligation in human thymus-derived T cell line, HPB-ALL cells.
17638906 2007 Lipid rafts and nonrafts mediate tumor necrosis factor related apoptosis-inducing ligand induced apoptotic and nonapoptotic signals in non small cell lung carcinoma cells.
17449468 2007 RBCK1 negatively regulates tumor necrosis factor- and interleukin-1-triggered NF-kappaB activation by targeting TAB2/3 for degradation.
17448597 2008 Marked gene transcript level alterations occur early during radical prostatectomy.
17389591 2007 RIP1-mediated AIP1 phosphorylation at a 14-3-3-binding site is critical for tumor necrosis factor-induced ASK1-JNK/p38 activation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17306544 2007 Ubiquitination of RIP1 regulates an NF-kappaB-independent cell-death switch in TNF signaling.
17301840 2007 RIP1, a kinase on the crossroads of a cell's decision to live or die.
17296724 2007 Interferon regulatory factor 7 is activated by a viral oncoprotein through RIP-dependent ubiquitination.
17235653 2007 Decreased expressions of the TNF-alpha signaling adapters in peripheral blood mononuclear cells (PBMCs) are correlated with disease activity in patients with systemic lupus erythematosus.
17047155 2007 Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation.
16825191 2006 The death domain kinase RIP has an important role in DNA damage-induced, p53-independent cell death.
16611992 2006 Competitive control of independent programs of tumor necrosis factor receptor-induced cell death by TRADD and RIP1.
16603398 2006 Activation of IKK by TNFalpha requires site-specific ubiquitination of RIP1 and polyubiquitin binding by NEMO.
16543241 2006 Ubiquitination of RIP is required for tumor necrosis factor alpha-induced NF-kappaB activation.
16507998 2006 Inhibition of ADP/ATP exchange in receptor-interacting protein-mediated necrosis.
16291755 2006 The tyrosine kinase Syk regulates TPL2 activation signals.
16260783 2005 TAK1 is recruited to the tumor necrosis factor-alpha (TNF-alpha) receptor 1 complex in a receptor-interacting protein (RIP)-dependent manner and cooperates with MEKK3 leading to NF-kappaB activation.
16127453 2005 IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.
16115877 2005 Rip1 mediates the Trif-dependent toll-like receptor 3- and 4-induced NF-{kappa}B activation but does not contribute to interferon regulatory factor 3 activation.
15814722 2005 Apoptosis induced by the toll-like receptor adaptor TRIF is dependent on its receptor interacting protein homotypic interaction motif.
15572679 2004 Restoration of NF-kappaB activation by tumor necrosis factor alpha receptor complex-targeted MEKK3 in receptor-interacting protein-deficient cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15258597 2004 De-ubiquitination and ubiquitin ligase domains of A20 downregulate NF-kappaB signalling.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15121855 2004 Focal adhesion kinase suppresses apoptosis by binding to the death domain of receptor-interacting protein.
15064760 2004 RIP1 is an essential mediator of Toll-like receptor 3-induced NF-kappa B activation.
15001576 2004 TRAF7 potentiates MEKK3-induced AP1 and CHOP activation and induces apoptosis.
14754897 2004 ZNF216 Is an A20-like and IkappaB kinase gamma-interacting inhibitor of NFkappaB activation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14653779 2004 The inhibitor ABIN-2 disrupts the interaction of receptor-interacting protein with the kinase subunit IKKgamma to block activation of the transcription factor NF-kappaB and potentiate apoptosis.
14644197 2003 Mechanisms of caspase activation.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14532286 2003 A role for tumor necrosis factor receptor-2 and receptor-interacting protein in programmed necrosis and antiviral responses.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12884866 2003 Caspase-8 and caspase-10 activate NF-kappaB through RIP, NIK and IKKalpha kinases.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12692549 2003 IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854271 2002 A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation.
11734559 2002 Identification of a novel homotypic interaction motif required for the phosphorylation of receptor-interacting protein (RIP) by RIP3.
11479302 2001 Critical roles of TRAF2 and TRAF5 in tumor necrosis factor-induced NF-kappa B activation and protection from cell death.
11429546 2001 The essential role of MEKK3 in TNF-induced NF-kappaB activation.
11369754 2001 Role of receptor-interacting protein in tumor necrosis factor-alpha -dependent MEKK1 activation.
11116146 2001 The epidermal growth factor receptor engages receptor interacting protein and nuclear factor-kappa B (NF-kappa B)-inducing kinase to activate NF-kappa B. Identification of a novel receptor-tyrosine kinase signalosome.
11101870 2000 Fas triggers an alternative, caspase-8-independent cell death pathway using the kinase RIP as effector molecule.
11002422 2000 Activation of death-inducing signaling complex (DISC) by pro-apoptotic C-terminal fragment of RIP.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
10880512 2000 An induced proximity model for NF-kappa B activation in the Nod1/RICK and RIP signaling pathways.
10837247 2000 The caspase-8 inhibitor FLIP promotes activation of NF-kappaB and Erk signaling pathways.
10744744 2000 Disruption of hsp90 function results in degradation of the death domain kinase, receptor-interacting protein (RIP), and blockage of tumor necrosis factor-induced nuclear factor-kappaB activation.
10521396 1999 Cleavage of the death domain kinase RIP by caspase-8 prompts TNF-induced apoptosis.
10409763 1999 The Epstein-Barr virus oncoprotein latent membrane protein 1 engages the tumor necrosis factor receptor-associated proteins TRADD and receptor-interacting protein (RIP) but does not induce apoptosis or require RIP for NF-kappaB activation.
10358032 1999 RIP3, a novel apoptosis-inducing kinase.
10356400 1999 The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation.
10339433 1999 Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB.
9927690 1999 Identification of a cell protein (FIP-3) as a modulator of NF-kappaB activity and as a target of an adenovirus inhibitor of tumor necrosis factor alpha-induced apoptosis.
9740801 1998 Essential requirement for caspase-8/FLICE in the initiation of the Fas-induced apoptotic cascade.
9430227 1997 Death receptor 5, a new member of the TNFR family, and DR4 induce FADD-dependent apoptosis and activate the NF-kappaB pathway.
9044836 1997 CRADD, a novel human apoptotic adaptor molecule for caspase-2, and FasL/tumor necrosis factor receptor-interacting protein RIP.
8985253 1997 RAIDD is a new 'death' adaptor molecule.
8702708 1996 Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.
8612133 1996 TNF-dependent recruitment of the protein kinase RIP to the TNF receptor-1 signaling complex.
7758105 1995 The TNF receptor 1-associated protein TRADD signals cell death and NF-kappa B activation.
7538908 1995 RIP: a novel protein containing a death domain that interacts with Fas/APO-1 (CD95) in yeast and causes cell death.