Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.32
PubTator Score 10.94

Knowledge Summary

Patent (1,069)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 7.6e-06
lung cancer 4473 4.5e-04
osteosarcoma 7933 2.2e-02
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 30 3.771 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.166 2.2e-02
lung cancer 1.900 4.5e-04
ovarian cancer 2.100 7.6e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
25891899 As RIO2 is involved in the biosynthesis of the ribosome and cell cycle regulation, our selective ligand may be useful for the delineation of the biological role of this kinase.
23459592 reduced expression of RIOK1 or RIOK2 disrupted Akt signaling and caused cell cycle exit, apoptosis, and chemosensitivity in glioblastoma cells
21880710 Plk1-mediated phosphorylation of Rio2 regulates metaphase-anaphase transition during mitotic progression.
19578876 Observational study of gene-disease association. (HuGE Navigator)
19564402 Results show that the protein kinase human Rio2 (hRio2) is part of a late 40S preribosomal particle in human cells.

AA Sequence

MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHKLIAWERTKTV      1 - 70
QGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRD     71 - 140
YHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHHVEDPASVYD    141 - 210
EAMELIVKLANHGLIHGDFNEFNLILDESDHITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYE    211 - 280
SELFPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGS    281 - 350
ENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEK    351 - 420
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSA    421 - 490
VSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWGE            491 - 552
//

Text Mined References (24)

PMID Year Title
25891899 2015 Discovery of selective RIO2 kinase small molecule ligand.
23459592 2013 A kinome-wide RNAi screen in Drosophila Glia reveals that the RIO kinases mediate cell proliferation and survival through TORC2-Akt signaling in glioblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21880710 2011 Phosphorylation of right open reading frame 2 (Rio2) protein kinase by polo-like kinase 1 regulates mitotic progression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19564402 2009 Distinct cytoplasmic maturation steps of 40S ribosomal subunit precursors require hRio2.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16183636 2005 A family portrait of the RIO kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.