Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.37
PubTator Score 15.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.2e-04
ovarian cancer 8491 1.4e-04
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.046 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.266 1.2e-04
ovarian cancer 1.700 1.4e-04

Protein-protein Interaction (13)

Gene RIF (8)

PMID Text
25304616 Results suggest that high RAD50 interactor 1 (RINT1) expression may represent a risk factor for low-grade gliomas (LGGs)-related seizures.
25050558 Results identified RINT1 as a putative breast cancer predisposition gene that also seems to be associated with risk for a spectrum of other cancers similar to those that have previously been described for Lynch syndrome.
23885118 RINT-1 is also required for endosome-to-trans-Golgi network trafficking.
23074196 RINT1 was validated as a novel glioblastoma oncogene
19369418 Results together suggest that NAG links between p31 and ZW10-RINT-1 and is involved in Golgi-to-ER transport.
17699596 Rab6 regulates distinct Golgi trafficking pathways involving two separate protein complexes: ZW10/RINT-1 and COG.
17470549 These findings suggest that RINT-1 serves as a novel tumor suppressor essential for maintaining the dynamic integrity of the Golgi apparatus and the centrosome, a prerequisite to their proper coordination during cell division.
16571679 RINT-1 coordinates the localization and function of ZW10 by serving as a link between ZW10 and the SNARE complex comprising syntaxin 18.

AA Sequence

MLPAGEIGASPAAPCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKS      1 - 70
LKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFSAINSHLLTAQP     71 - 140
WMDDLGTMISQIEEIERHLAYLKWISQIEELSDNIQQYLMTNNVPEAASTLVSMAELDIKLQESSCTHLL    141 - 210
GFMRATVKFWHKILKDKLTSDFEEILAQLHWPFIAPPQSQTVGLSRPASAPEIYSYLETLFCQLLKLQTS    211 - 280
DELLTEPKQLPEKYSLPASPSVILPIQVMLTPLQKRFRYHFRGNRQTNVLSKPEWYLAQVLMWIGNHTEF    281 - 350
LDEKIQPILDKVGSLVNARLEFSRGLMMLVLEKLATDIPCLLYDDNLFCHLVDEVLLFERELHSVHGYPG    351 - 420
TFASCMHILSEETCFQRWLTVERKFALQKMDSMLSSEAAWVSQYKDITDVDEMKVPDCAETFMTLLLVIT    421 - 490
DRYKNLPTASRKLQFLELQKDLVDDFRIRLTQVMKEETRASLGFRYCAILNAVNYISTVLADWADNVFFL    491 - 560
QLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLERLKHDMLTRQVDHVFREVKDAAKLYKKERW    561 - 630
LSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGG    631 - 700
AAQLQFDMTRNLFPLFSHYCKRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIY    701 - 770
KLAQQDVEILLNLRTNWPNTGK                                                    771 - 792
//

Text Mined References (26)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25304616 2015 Expression of RINT1 predicts seizure occurrence and outcomes in patients with low-grade gliomas.
25050558 2014 Rare mutations in RINT1 predispose carriers to breast and Lynch syndrome-spectrum cancers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
23885118 2013 A new role for RINT-1 in SNARE complex assembly at the trans-Golgi network in coordination with the COG complex.
23074196 2012 Integrative functional genomics identifies RINT1 as a novel GBM oncogene.
21269460 2011 Initial characterization of the human central proteome.
20462495 2010 Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
19369418 2009 Identification of the neuroblastoma-amplified gene product as a component of the syntaxin 18 complex implicated in Golgi-to-endoplasmic reticulum retrograde transport.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17699596 2007 Rab6 regulates both ZW10/RINT-1 and conserved oligomeric Golgi complex-dependent Golgi trafficking and homeostasis.
17470549 2007 RINT-1 serves as a tumor suppressor and maintains Golgi dynamics and centrosome integrity for cell survival.
16600870 2006 The Rb-related p130 protein controls telomere lengthening through an interaction with a Rad50-interacting protein, RINT-1.
16571679 2006 RINT-1 regulates the localization and entry of ZW10 to the syntaxin 18 complex.
15824131 2005 ZW10 links mitotic checkpoint signaling to the structural kinetochore.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15272311 2004 Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion.
15029241 2004 Implication of ZW10 in membrane trafficking between the endoplasmic reticulum and Golgi.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11096100 2001 RINT-1, a novel Rad50-interacting protein, participates in radiation-induced G(2)/M checkpoint control.
9847074 1998 Toward a complete human genome sequence.