Property Summary

NCBI Gene PubMed Count 21
PubMed Score 17.82
PubTator Score 8.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.500 3.3e-06
osteosarcoma -1.952 1.5e-05
astrocytoma 1.600 5.0e-03
glioblastoma 1.400 1.8e-02
non-small cell lung cancer -1.196 2.7e-16
pilocytic astrocytoma 1.100 1.3e-04
aldosterone-producing adenoma -1.097 1.2e-02
COPD -1.300 6.2e-03
lung carcinoma -1.100 5.5e-20
gastric carcinoma 1.200 1.4e-02

Protein-protein Interaction (2)

Gene RIF (8)

PMID Text
26296892 discovered novel interaction candidates for CD2AP and characterized subtle yet significant differences in the recognition preferences of its three SH3 domains for c-CBL, ALIX, and RIN3
25701875 RIN3 may contribute to Paget's disease of bone susceptibility by affecting osteoclast function.
24945404 The study reports a novel association between a variant within RIN3 and lower limb-bone mineral density and note its previous association with risk of Paget's disease.
23185384 RIN3 is a negative regulator of mast cell responses to SCF
21586568 RIN3 specifically acts as a GEF for Rab31.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18486601 Tyrosine-phosphorylation signals are involved in the RIN3 activation and translocation to early endocytic vesicles.
12972505 RIN3 biochemically characterized as the stimulator and stabilizer for GTP-Rab5 plays an important role in the transport pathway from plasma membrane to early endosomes

AA Sequence

MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTCPVWLQLSLGQ      1 - 70
AEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSALVFEDIFRLI     71 - 140
AFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFWDSSLNPPQERGKPAEPPRDRAPGFPLVSSL    141 - 210
RPTAHDANCACEIELSVGNDRLWFVNPIFIEDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRP    211 - 280
PPPPPVLPLQPCSPAQPPVLPALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAG    281 - 350
LGPLREEAMKPGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD    351 - 420
GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLENAELCTQAMAL    421 - 490
ETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGVSVMATDQDSYSTSSTEEELE    491 - 560
QFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRKLYKKVVELAQDKGSYFGSLVQDYKVYSLEM    561 - 630
MARQTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLH    631 - 700
QIHSKDGSLQQLKENQLVILATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIY    701 - 770
DSMALGNPGKPYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY    771 - 840
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADTQAQALCAQCA    841 - 910
EKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVYRPLDGGGGGGGGSPPCLVVR    911 - 980
EPNFL                                                                     981 - 985
//

Text Mined References (21)

PMID Year Title
26296892 2015 Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25701875 2015 Targeted sequencing of the Paget's disease associated 14q32 locus identifies several missense coding variants in RIN3 that predispose to Paget's disease of bone.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
23185384 2012 RIN3 is a negative regulator of mast cell responses to SCF.
21623375 2011 Genome-wide association identifies three new susceptibility loci for Paget's disease of bone.
21586568 2011 Characterization of RIN3 as a guanine nucleotide exchange factor for the Rab5 subfamily GTPase Rab31.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18486601 2008 Tyr-phosphorylation signals translocate RIN3, the small GTPase Rab5-GEF, to early endocytic vesicles.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972505 2003 RIN3: a novel Rab5 GEF interacting with amphiphysin II involved in the early endocytic pathway.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11733506 2002 A novel binding protein composed of homophilic tetramer exhibits unique properties for the small GTPase Rab5.