Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.77
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.100 6.8e-05
Astrocytoma, Pilocytic -2.100 2.4e-08
atypical teratoid / rhabdoid tumor -2.300 9.9e-09
ependymoma -2.300 6.6e-19
glioblastoma -1.600 1.4e-05
group 3 medulloblastoma -1.500 4.7e-03
medulloblastoma, large-cell -2.100 6.3e-05
pituitary cancer 1.300 3.0e-05
primitive neuroectodermal tumor -1.500 1.4e-03
psoriasis -1.900 1.6e-26

Gene RIF (2)

AA Sequence

MERSQSRLSLSASFEALAIYFPCMNSFDDEDAGDSRRLKGAIQRSTETGLAVEMPSRTLRQASHESIEDS      1 - 70
MNSYGSEGNLNYGGVCLASDAQFSDFLGSMGPAQFVGRQTLATTPMGDVEIGLQERNGQLEVDIIQARGL     71 - 140
TAKPGSKTLPAAYIKAYLLENGICIAKKKTKVARKSLDPLYNQVLLFPESPQGKVLQVIVWGNYGRMERK    141 - 210
QFMGVARVLLEELDLTTLAVGWYKLFPTSSMVDPATGPLLRQASQLSLESTVGPCGERS               211 - 269
//

Text Mined References (9)

PMID Year Title