Property Summary

NCBI Gene PubMed Count 38
PubMed Score 81.50
PubTator Score 39.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.300 1.2e-03
posterior fossa group A ependymoma -5.000 9.4e-18
oligodendroglioma -2.900 3.3e-03
glioblastoma -4.300 6.0e-07
medulloblastoma -3.900 9.4e-08
atypical teratoid / rhabdoid tumor -4.800 4.8e-10
medulloblastoma, large-cell -5.200 1.6e-07
primitive neuroectodermal tumor -3.300 1.7e-03
adult high grade glioma -4.100 6.2e-06
pilocytic astrocytoma -3.300 6.9e-09
subependymal giant cell astrocytoma -3.034 1.0e-02
Pick disease -1.400 1.7e-03
head and neck cancer and chronic obstruc... -1.100 2.5e-02
psoriasis -1.400 3.7e-17

 OMIM Phenotype (1)

Gene RIF (10)

PMID Text
22248876 Here, we report that, like Rab3A, RIM and Munc13 are present in human sperm and that they play a functional role in acrosomal exocytosis before the acrosomal calcium efflux
21402706 a novel functional coupling between RIM1 and the L-type Ca(V) channels via the Ca(V)beta auxiliary subunit that contribute to determine insulin secretion.
21331761 Rim1 modulates direct G-protein regulation of Ca(v)2.2 channels.
20801516 Observational study of genetic testing. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17237123 A possible role for RIMS1 in the enhancement of cognitive function at least in this kindred is suggested.
15746564 Even though the absence of pathogenic mutations suggests that RIM1 is notinvolved in autosomal recessive retinitis pigmentosa.
12871946 Rim1 is a component of the presynaptic active zone and modulator of exocytosis and binds 14-3-3 through its N terminus

AA Sequence

MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTP      1 - 70
RNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFC     71 - 140
ARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFFGSGPQQTSQDGTLSDTATGAGSEVPREKKA    141 - 210
RLQERSRSQTPLSTAAASSQDAAPPSAPPDRSKGAEPSQQALGPEQKQASSRSRSEPPRERKKTPGLSEQ    211 - 280
NGKGALKSERKRVPKTSAQPVEGAVEERERKERRESRRLEKGRSQDYPDTPEKRDEGKAADEEKQRKEED    281 - 350
YQTRYRSDPNLARYPVKPPPEEQQMRMHARVSRARHERRHSDVALPRTEAGAALPEGKAGKRAPAAARAS    351 - 420
PPDSPRAYSAERTAETRAPGAKQLTNHSPPAPRHGPVPAEAPELKAQEPLRKQSRLDPSSAVLMRKAKRE    421 - 490
KVETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKG    491 - 560
DLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRVILNKRTTMPKDSGALLGLKVVGGKMTDLGR    561 - 630
LGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIP    631 - 700
ESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLP    701 - 770
ARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQE    771 - 840
EESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQRSQRISDSDIS    841 - 910
DYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDE    911 - 980
IHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTRHLVRHYKTLPP    981 - 1050
KMPLLQSSSHWNIYSSILPAHTKTKSVTRQDISLHHECFNSTVLRFTDEILVSELQPFLDRARSASTNCL   1051 - 1120
RPDTSLHSPERERGRWSPSLDRRRPPSPRIQIQHASPENDRHSRKSERSSIQKQTRKGTASDAERVLPTC   1121 - 1190
LSRRGHAAPRATDQPVIRGKHPARSRSSEHSSIRTLCSMHHLVPGGSAPPSPLLTRMHRQRSPTQSPPAD   1191 - 1260
TSFSSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDREQYSKYNIHKDQYR   1261 - 1330
SCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRSIMKSTS   1331 - 1400
VSGEMYTLEHNDGSQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRST   1401 - 1470
ETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMG   1471 - 1540
DIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVF   1541 - 1610
DESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSS   1611 - 1680
LESSTGPPCIRS                                                             1681 - 1692
//

Text Mined References (42)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
24009623 2013 Genome-wide association study for biomarker identification of Rapamycin and Everolimus using a lymphoblastoid cell line system.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22248876 2012 RIM, Munc13, and Rab3A interplay in acrosomal exocytosis.
21402706 2011 Functional coupling of Rab3-interacting molecule 1 (RIM1) and L-type Ca2+ channels in insulin release.
21331761 2011 Rim1 modulates direct G-protein regulation of Ca(v)2.2 channels.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17237123 2007 Genetic enhancement of cognition in a kindred with cone-rod dystrophy due to RIMS1 mutation.
16722236 2006 The role of SNARE proteins in trafficking and function of neurotransmitter transporters.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15746564 Molecular analysis of RIM1 in autosomal recessive Retinitis pigmentosa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12871946 2003 Rim, a component of the presynaptic active zone and modulator of exocytosis, binds 14-3-3 through its N terminus.
12659814 2003 Genomic organisation and alternative splicing of human RIM1, a gene implicated in autosomal dominant cone-rod dystrophy (CORD7).
12620390 2003 Genomic definition of RIM proteins: evolutionary amplification of a family of synaptic regulatory proteins.
12578829 2003 Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2. Identification of a critical determinant of Rab3A/Rab27A recognition by Rim2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391317 2002 A family of RIM-binding proteins regulated by alternative splicing: Implications for the genesis of synaptic active zones.
12163476 2002 Cast: a novel protein of the cytomatrix at the active zone of synapses that forms a ternary complex with RIM1 and munc13-1.
11797009 2002 RIM1alpha forms a protein scaffold for regulating neurotransmitter release at the active zone.
11438522 2001 Actin cytoskeletal association of cytohesin-1 is regulated by specific phosphorylation of its carboxyl-terminal polybasic domain.
11438521 2001 Induction of neurite outgrowth in PC12 cells by alpha -phenyl-N-tert-butylnitron through activation of protein kinase C and the Ras-extracellular signal-regulated kinase pathway.
11438520 2001 Mutations of either or both Cys876 and Cys888 residues of sarcoplasmic reticulum Ca2+-ATPase result in a complete loss of Ca2+ transport activity without a loss of Ca2+-dependent ATPase activity. Role of the CYS876-CYS888 disulfide bond.
11438519 2001 HIV Nef-mediated cellular phenotypes are differentially expressed as a function of intracellular Nef concentrations.
11438518 2001 Direct interaction of the Rab3 effector RIM with Ca2+ channels, SNAP-25, and synaptotagmin.
11343654 2001 Functional interaction of the active zone proteins Munc13-1 and RIM1 in synaptic vesicle priming.
9634506 1998 Localization of a gene (CORD7) for a dominant cone-rod dystrophy to chromosome 6q.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.