Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.08
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.665 1.8e-06
medulloblastoma, large-cell -1.700 1.7e-04
non-small cell lung cancer -1.278 8.5e-27
active Crohn's disease 1.717 4.7e-03
ulcerative colitis 2.200 4.8e-08
lung adenocarcinoma -1.400 2.8e-10
group 4 medulloblastoma -1.500 4.9e-05
lung carcinoma -1.200 5.4e-19
acute myeloid leukemia 1.100 1.9e-02
ovarian cancer -1.900 1.4e-06

AA Sequence

MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVR      1 - 70
VLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRD     71 - 140
VLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQ    141 - 210
T//

Text Mined References (13)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14668488 2004 A unique region of RILP distinguishes it from its related proteins in its regulation of lysosomal morphology and interaction with Rab7 and Rab34.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
5230296 1967 [Early orthodontic treatment by means of the standardized vestibular plate].