Property Summary

NCBI Gene PubMed Count 77
PubMed Score 560.31
PubTator Score 390.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (56)

PMID Text
26600389 Mdm20 acts as a novel regulator of Rictor, thereby controlling mTORC2 activity, and leading to the activation of PKCalphaS657 and FoxO1.
26453307 RICTOR/MTORC2-AKT can integrate convergent hormonal and metabolic signals to provide coordinated and sensitive regulation of hepatic FOXO1-target gene expression.
26370156 RICTOR amplification may define a novel and unique molecular subset of patients with lung cancer who may benefit from treatment with mTORC1/2 inhibitors.
26363527 the expressions of Beclin1, Raptor, and Rictor are related to the development and progression of colorectal carcinoma and multidrug resistance.
26356562 Data show that rapamycin-insensitive companion of mTOR protein (RICTOR) plays a central role in phosphatidylinositol 3-kinase (PI3K)/proto-oncogene protein c-akt (AKT) pathway in melanocytes and its deregulation could be involved in melanoma development.
26170313 glucose-dependent acetylation of Rictor, a central component of mechanistic target of rapamycin complex 2 (mTORC2), promotes tumor growth and resistance to epidermal growth factor receptor (EGFR)-, PI3K-, and AKT-targeted therapies
26159923 results suggest that mTORC2/Rictor/pAkt may play a more important role than mTORC1/pS6 in tumor progression, which could act as a prognostic biomarker or potential therapeutic target in gastric cancer
25897075 analysis of how Rictor undergoes GSK3-dependent, FBXW7-mediated ubiquitination and proteasomal degradation
25893736 A new dimension in mTOR-rictor relationship.
25714006 phosphorylation of Rictor at Ser1162 by Plk1 might be involved in a novel signaling pathway.
25378594 these data provide evidence that rictor is a multifunctional signaling regulator that can regulate FcepsilonRI-mediated degranulation independently of mTORC2.
24966915 Rictor is an independent prognostic factor for endometrial carcinoma.
24270265 These data provide a novel mechanistic link of Nox4-dependent activation of mTORC2 via the energy sensor AMP-activated protein kinase to increased proliferation and survival of PAVSMCs in pulmonary artery hypertension.
24086535 Rictor contributes to cisplatin resistance in human ovarian cancer cells by suppressing cisplatin-induced apoptosis and by activating and stabilizing Akt.
24006489 Data indicate mTOR kinase-independent function and mechanism of Rictor in the regulation of neutrophil chemotaxis, and suggest that the small Rho GTPases Rac and Cdc42 serve as downstream effectors of Rictor to regulate actin assembly.
23898069 Histolopathological and clinical information including tumour stage, invasion characteristic and endocrine status were analysed against the gene transcript expression of mTOR, RAPTOR and RICTOR.
23872070 IKK interacts with rictor and regulates the function of mTORC2 including phosphorylation of AKT (at Serine473) and organization of actin cytoskeleton.
23762398 NBS1 interacts with the mTOR/Rictor/SIN1 complex through the a.a. 221-402 domain and contributes to the activation of Akt activity.
23555046 combined silencing of EGFR and Rictor should be an effective means of treating glioblastoma
23503572 The expression of Raptor was associated with a higher tumour grade.
23455608 Reduced mTORC2 activity impairs both long-term memory and the late phase of hippocampal long-term potentiation.
23067215 High rictor expression is associated with hemangioendothelioma.
22777355 Rictor by suppressing RhoGDI2 promotes activity of the Rho proteins and cell migration.
22384145 analysis of the role of RICTOR in beta1 integrin-mediated cell survival and how receptor-specific mechanisms regulate phosphorylation of AKT at Ser473
22285861 these results suggest that elevated growth factor signaling may contribute to decrease rictor/FBXW7-mediated ubiquitination of c-Myc and cyclin E, thus leading to accumulation of cyclin E and c-Myc in colorectal cancer cells.
22084251 multiple-site acetylation of Rictor signals for increased activation of mTORC2, providing a critical link between nutrient-sensitive deacetylases and mTORC2 signaling to Akt
22080063 RICTOR overexpression in sarcomas and its links to therapeutic response need to be assessed
21795477 Rictor is a novel target of miR-218, suggesting that activation of the mTOR-Akt signaling pathway induced by Rictor contributes centrally to oral carcinogenesis.
21343617 in response to cellular stress, GSK-3beta restrains mTORC2-Akt signaling by specifically phosphorylating rictor, thereby balancing the activities of GSK-3beta and Akt, two opposing players in glucose metabolism
21177249 PINK1 exerts its cytoprotective function not only in mitochondria but also in the cytoplasm through activation of mTORC2
21170086 There is an increased mitochondrial dependence upon mTORC2 dependent cell growth due to PTEN loss
20978191 Fndings identify Rictor as an important mediator of chemotaxis and metastasis in breast cancer cells.
20832730 Rictor forms a complex with Cullin-1 to promote SGK1 ubiquitination and destruction.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20501647 Rictor phosphorylation takes place in mammalian target of rapamycin (mTORC)2-deficient cells; this modification may play a role in regulating not only mTORC2 but also the mTORC2-independent function of rictor.
20438709 This study reveals that mTORC2 is a critical target of PLD-mediated survival signals and identifies SGK1 as a downstream target of mTORC2 for the stabilization of HDM2.
20412774 FoxOs inhibit mTORC1 and activate Akt by inducing the expression of Sestrin3 and Rictor
20338997 SGK1 interacted selectively with rictor but not with raptor, suggesting selective recruitment of SGK1 to mTORC2.
20226010 The inhibition of mTORC2 reduces colon cancer cell proliferation in vitro and tumor xenograft formation in vivo.
19995915 found that Rictor phosphorylation requires mTOR complex 1 activity and, more specifically, the p70 ribosomal S6 kinase 1 (S6K1).
19934294 inhibition of the mTORC2 protein Rictor leads to growth inhibition and induces apoptosis in both rapamycin-sensitive and rapamycin-resistant colorectal cancers
19724909 Report involvement of mTORC1 and mTORC2 in regulation of glioblastoma multiforme growth and motility.
19402821 This study describes the small molecule Ku-0063794, which inhibits both mTORC1 and mTORC2, but does not suppress the activity of 76 other protein kinases or seven lipid kinases.
19341427 mTORC1 and mTORC2 complexes have distinct, non-redundant functions in MO7e MK cell proliferation, and development
19145465 S2448 phosphorylated mTOR binds to both raptor and rictor.
19018001 mTORC2 and Akt facilitate CD40-inducible expression of VEGF in endothelial cells
18831768 TORC2 inhibition reduced proliferation and anchorage-independent growth of breast cancer and prostate cancer cell lines.
18776922 there are two parallel cell-survival pathways in prostate cancer cells: a strong Akt-independent, but rapamycin-sensitive pathway downstream of mTORC1, and an AR-dependent pathway downstream of mTORC2 and Akt, that is stimulated by mTORC1 inhibition
18505677 Hsp70 was isolated as a putative Rictor interacting protein.
18089801 mTORC2 is hyperactivated in gliomas and promotes tumor cell proliferation and invasive potential due to increased complex formation as a result of the overexpression of rictor.
17461779 It was demonstrated that immunoprecipitation of Protor-1 or Protor-2 results in the co-immunoprecipitation of other mTORC2 subunits, but not Raptor, a specific component of mTORC1.
17329400 ASCT2 silencing inhibits mTORC1 (mTOR/raptor) signaling and leads to growth repression, followed by enhanced survival signaling via mTORC2 (mTOR/rictor) and apoptosis of hepatoma cells.
17043309 Sin1 together with Rictor are key components of mTORC2 and play an essential role in Akt phosphorylation and signaling
16962653 Results reveal that the SIN1-rictor-mTOR function in Akt-Ser473 phosphorylation is required for TORC2 function in cell survival but is dispensable for TORC1 function.
16959881 These data suggest that, during HCMV infection, the rictor- and raptor-containing complexes are modified such that their substrate specificities and rapamycin sensitivities are altered.
15718470 results show show that target of rapamycin (TOR) kinase and its associated protein rictor are necessary for AKT/PKB Ser473 phosphorylation and that a reduction in rictor or mammalian TOR (mTOR) expression inhibited an Akt/PKB effector

AA Sequence

MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDI      1 - 70
GHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDIQQSNE     71 - 140
VERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNT    141 - 210
ILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREAR    211 - 280
FLASKMGIIATFRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEAL    281 - 350
LSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHIS    351 - 420
VRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPY    421 - 490
SLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQHKENLEWNWNLIGTILKWPNV    491 - 560
NLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDI    561 - 630
VQWLNASSGMKPERSLQNNGLLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKL    631 - 700
TVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEA    701 - 770
LDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYV    771 - 840
DLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVR    841 - 910
TPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTKQ    911 - 980
GCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPSTLSLNSESTSSRHNSESESVPSSMFILEDD    981 - 1050
RFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKL   1051 - 1120
SSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFG   1121 - 1190
TENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVS   1191 - 1260
TKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAFGY   1261 - 1330
ATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRFMKALSYASLDKEDLLSPINQ   1331 - 1400
NTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIPYFQTKNIPPHDDRGARAFAHDAGGLPS   1401 - 1470
GTGGLVKNSFHLLRQQMSLTEIMNSIHSDASLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAI   1471 - 1540
CSHSDFQDIPYSDWCEQTIHNPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLLGVKTIPDDTPMCRI   1541 - 1610
LLRKEVLRLVINLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDV   1611 - 1680
QFLQMHEEAEAVLATPPKQPIVDTSAES                                             1681 - 1708
//

Text Mined References (93)

PMID Year Title
26600389 2015 Mdm20 Modulates Actin Remodeling through the mTORC2 Pathway via Its Effect on Rictor Expression.
26453307 2016 Hepatic FOXO1 Target Genes Are Co-regulated by Thyroid Hormone via RICTOR Protein Deacetylation and MTORC2-AKT Protein Inhibition.
26370156 2015 RICTOR Amplification Defines a Novel Subset of Patients with Lung Cancer Who May Benefit from Treatment with mTORC1/2 Inhibitors.
26363527 2015 Autophagy-related genes Raptor, Rictor, and Beclin1 expression and relationship with multidrug resistance in colorectal carcinoma.
26356562 2015 RICTOR involvement in the PI3K/AKT pathway regulation in melanocytes and melanoma.
26170313 2015 Glucose-dependent acetylation of Rictor promotes targeted cancer therapy resistance.
26159923 2015 Elevated Rictor expression is associated with tumor progression and poor prognosis in patients with gastric cancer.
25897075 2015 Rictor Undergoes Glycogen Synthase Kinase 3 (GSK3)-dependent, FBXW7-mediated Ubiquitination and Proteasomal Degradation.
25893736 2015 A carbazole alkaloid deactivates mTOR through the suppression of rictor and that induces apoptosis in lung cancer cells.
25714006 2015 Identification of rictor as a novel substrate of Polo-like kinase 1.
25378594 2014 Rictor negatively regulates high-affinity receptors for IgE-induced mast cell degranulation.
24966915 2014 Rictor is an independent prognostic factor for endometrial carcinoma.
24375676 2014 mTORC2 phosphorylates protein kinase C? to regulate its stability and activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270265 2014 Mammalian target of rapamycin complex 2 (mTORC2) coordinates pulmonary artery smooth muscle cell metabolism, proliferation, and survival in pulmonary arterial hypertension.
24086535 2013 The mTORC2 component rictor contributes to cisplatin resistance in human ovarian cancer cells.
24036451 2013 PIH1D1 interacts with mTOR complex 1 and enhances ribosome RNA transcription.
24006489 2013 Mammalian target of rapamycin and Rictor control neutrophil chemotaxis by regulating Rac/Cdc42 activity and the actin cytoskeleton.
23953116 2013 Inhibition of mTORC1 by astrin and stress granules prevents apoptosis in cancer cells.
23898069 2013 Expression of the mTOR pathway regulators in human pituitary adenomas indicates the clinical course.
23872070 2013 IKK interacts with rictor and regulates mTORC2.
23762398 2013 Interaction between NBS1 and the mTOR/Rictor/SIN1 complex through specific domains.
23727834 2013 The Bardet-Biedl syndrome-related protein CCDC28B modulates mTORC2 function and interacts with SIN1 to control cilia length independently of the mTOR complex.
23555046 2013 Combined RNAi-mediated suppression of Rictor and EGFR resulted in complete tumor regression in an orthotopic glioblastoma tumor model.
23503572 2013 Prognostic and therapeutic implications of mTORC1 and Rictor expression in human breast cancer.
23455608 2013 mTORC2 controls actin polymerization required for consolidation of long-term memory.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23067215 2013 Targeting rictor inhibits mouse vascular tumor cell proliferation and invasion in vitro and tumor growth in vivo.
22777355 2013 Rictor regulates cell migration by suppressing RhoGDI2.
22384145 2012 Receptor-specific mechanisms regulate phosphorylation of AKT at Ser473: role of RICTOR in ?1 integrin-mediated cell survival.
22285861 2012 Rictor regulates FBXW7-dependent c-Myc and cyclin E degradation in colorectal cancer cells.
22084251 2012 Multiple site acetylation of Rictor stimulates mammalian target of rapamycin complex 2 (mTORC2)-dependent phosphorylation of Akt protein.
22080063 2012 From PTEN loss of expression to RICTOR role in smooth muscle differentiation: complex involvement of the mTOR pathway in leiomyosarcomas and pleomorphic sarcomas.
21964062 2012 Protor-2 interacts with tristetraprolin to regulate mRNA stability during stress.
21795477 2011 The tumor suppressive microRNA miR-218 targets the mTOR component Rictor and inhibits AKT phosphorylation in oral cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21376236 2011 Activation of mTORC2 by association with the ribosome.
21343617 2011 ER stress inhibits mTORC2 and Akt signaling through GSK-3?-mediated phosphorylation of rictor.
21339740 2011 Selective activation of Akt1 by mammalian target of rapamycin complex 2 regulates cancer cell migration, invasion, and metastasis.
21269460 2011 Initial characterization of the human central proteome.
21177249 2011 A new cytosolic pathway from a Parkinson disease-associated kinase, BRPK/PINK1: activation of AKT via mTORC2.
21170086 2011 Genome-wide shRNA screen reveals increased mitochondrial dependence upon mTORC2 addiction.
21045808 2010 mTORC2 can associate with ribosomes to promote cotranslational phosphorylation and stability of nascent Akt polypeptide.
20978191 2010 mTOR complex component Rictor interacts with PKCzeta and regulates cancer cell metastasis.
20832730 2010 Rictor forms a complex with Cullin-1 to promote SGK1 ubiquitination and destruction.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20501647 2010 Rictor phosphorylation on the Thr-1135 site does not require mammalian target of rapamycin complex 2.
20438709 2010 Phospholipase D stabilizes HDM2 through an mTORC2/SGK1 pathway.
20412774 2010 FoxOs inhibit mTORC1 and activate Akt by inducing the expression of Sestrin3 and Rictor.
20338997 2010 mTOR complex-2 activates ENaC by phosphorylating SGK1.
20226010 2010 Targeting mTORC2 inhibits colon cancer cell proliferation in vitro and tumor formation in vivo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19995915 2010 mTORC1-activated S6K1 phosphorylates Rictor on threonine 1135 and regulates mTORC2 signaling.
19934294 2009 Targeted inhibition of mammalian target of rapamycin signaling inhibits tumorigenesis of colorectal cancer.
19875983 2009 The target of rapamycin complex 2 controls dendritic tiling of Drosophila sensory neurons through the Tricornered kinase signalling pathway.
19724909 2009 Involvement of mTORC1 and mTORC2 in regulation of glioblastoma multiforme growth and motility.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19446321 2009 DEPTOR is an mTOR inhibitor frequently overexpressed in multiple myeloma cells and required for their survival.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19402821 2009 Ku-0063794 is a specific inhibitor of the mammalian target of rapamycin (mTOR).
19341427 2009 Distinct roles of the mTOR components Rictor and Raptor in MO7e megakaryocytic cells.
19145465 2010 mTOR phosphorylated at S2448 binds to raptor and rictor.
19018001 2008 CD40-induced signaling in human endothelial cells results in mTORC2- and Akt-dependent expression of vascular endothelial growth factor in vitro and in vivo.
18831768 2008 TOR complex 2 is needed for cell cycle progression and anchorage-independent growth of MCF7 and PC3 tumor cells.
18776922 2008 Regulation of androgen receptor transcriptional activity by rapamycin in prostate cancer cell proliferation and survival.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566587 2008 Essential function of TORC2 in PKC and Akt turn motif phosphorylation, maturation and signalling.
18505677 2008 Hsp70 associates with Rictor and is required for mTORC2 formation and activity.
18339839 2008 Rictor and integrin-linked kinase interact and regulate Akt phosphorylation and cancer cell survival.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18089801 2007 mTORC2 activity is elevated in gliomas and promotes growth and cell motility via overexpression of rictor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17599906 2007 PRR5, a novel component of mTOR complex 2, regulates platelet-derived growth factor receptor beta expression and signaling.
17565979 2007 P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration.
17461779 2007 Identification of Protor as a novel Rictor-binding component of mTOR complex-2.
17329400 2007 ASCT2 silencing regulates mammalian target-of-rapamycin growth and survival signaling in human hepatoma cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043309 2006 Identification of Sin1 as an essential TORC2 component required for complex formation and kinase activity.
16962653 2006 SIN1/MIP1 maintains rictor-mTOR complex integrity and regulates Akt phosphorylation and substrate specificity.
16959881 2006 Human cytomegalovirus infection alters the substrate specificities and rapamycin sensitivities of raptor- and rictor-containing complexes.
15718470 2005 Phosphorylation and regulation of Akt/PKB by the rictor-mTOR complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467718 2004 Mammalian TOR complex 2 controls the actin cytoskeleton and is rapamycin insensitive.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15268862 2004 Rictor, a novel binding partner of mTOR, defines a rapamycin-insensitive and raptor-independent pathway that regulates the cytoskeleton.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056414 2002 Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.