Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.22
PubTator Score 31.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
subependymal giant cell astrocytoma -1.263 2.9e-02
lung carcinoma 2.200 1.3e-33
Pick disease -1.400 5.6e-07
Breast cancer -2.400 3.6e-17

Gene RIF (18)

PMID Text
26258666 expression of chaperones such as Ric-3 can influence proteins associating with alpha7-nAChRs
23586521 RIC-3 differentially regulates assembly and expression of different nicotinic receptor subunits. These results also show that nicotine-mediated upregulation of alpha4beta2 receptors can be dynamically regulated by the presence of the chaperone, RIC-3.
23153976 RIC-3 gene rs1528133 variation was not found to be effective over any analyzed obesity related parameter, but associated with higher glycemic load, protein and fat eating behavior and antihypertensive drug use
22970690 Xenopus laevis RIC-3 is more effective than either the homomeric human or C. elegans protein in chaperoning the expression of nematode nicotinic receptor ACR-16 in Xenopus oocytes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20522555 RIC-3 exclusively enhances the surface expression of human homomeric 5-hydroxytryptamine type 3A (5-HT3A) receptors despite direct interactions with 5-HT3A, -C, -D, and -E subunits.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18691158 The RIC-3e protein is functionally active and enables surface expression of mature alpha7-nAChRs in cell lines not otherwise permissive for the expression of this receptor.
18471073 we describe the generation and functional and pharmacological characterization of a Chinese hamster ovary (CHO)-K1 cell line co-expressing the human alpha7 nAChR and RIC-3
18246096 this review provides a brief history of RIC-3--REVIEW
18208544 When expressed in a human cell line, human RIC-3 enhances neuronal nicotinic acetylcholine receptor maturation more efficiently than Drosophila melanogaster RIC-3.
18179477 Immunohistochemistry demonstrated the presence of RIC-3 in rat brain localized, in general, in places where alpha7 nAChRs were found.
17609200 both isoforms of RIC-3 play a role in determining 5-HT3 receptor composition.
17192664 Mutations in the ric-3 gene affect maturation of nicotinic acetylcholine receptors.
15927954 hRIC-3 can act as a specific regulator of alpha7 and 5-HT3 expression at different levels by increasing the number of mature receptors and facilitating its transport to the membrane
15809299 RIC-3 may play a role in 5-HT(3A) receptor folding, assembly, or transport to the cell surface
15504725 ric-3 appears to be necessary for proper folding and/or assembly of alpha7 receptors in HEK293 cells
12821669 the hric3 locus encodes for multiple transcripts, is likely to produce multiple hric3 isoforms, and hric3 is expressed in neurons and muscles, thus enabling its interactions with nicotinic acetylcholine receptors in vivo

AA Sequence

MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAPSDGQTPGARFQRS      1 - 70
HLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHR     71 - 140
KITSFELAQLQEKLKETEAAMEKLINRVGPNGESRAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPE    141 - 210
KEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWES    211 - 280
LPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGIS    281 - 350
TDKAYTGSMLRKRNPQGLE                                                       351 - 369
//

Text Mined References (39)

PMID Year Title
27055476 2016 Evidence of mutations in RIC3 acetylcholine receptor chaperone as a novel cause of autosomal-dominant Parkinson's disease with non-motor phenotypes.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26838027 2016 Multidisciplinary investigation links backward-speech trait and working memory through genetic mutation.
26258666 2015 Resistance to Inhibitors of Cholinesterase 3 (Ric-3) Expression Promotes Selective Protein Associations with the Human ?7-Nicotinic Acetylcholine Receptor Interactome.
24616004 2014 Genetic modifiers of cognitive maintenance among older adults.
23586521 2013 RIC-3 differentially modulates ?4?2 and ?7 nicotinic receptor assembly, expression, and nicotine-induced receptor upregulation.
23153976 Relationship of RIC-3 gene rs1528133 polymorphism with varying degrees of body weight and eating behavior.
22970690 2012 Xenopus laevis RIC-3 enhances the functional expression of the C. elegans homomeric nicotinic receptor, ACR-16, in Xenopus oocytes.
22040696 2012 Chaperoning ?7 neuronal nicotinic acetylcholine receptors.
20668195 2010 Ric-3 promotes alpha7 nicotinic receptor assembly and trafficking through the ER subcompartment of dendrites.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20522555 2010 RIC-3 exclusively enhances the surface expression of human homomeric 5-hydroxytryptamine type 3A (5-HT3A) receptors despite direct interactions with 5-HT3A, -C, -D, and -E subunits.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19116311 2009 The conserved RIC-3 coiled-coil domain mediates receptor-specific interactions with nicotinic acetylcholine receptors.
18956371 2008 RIC-3 and nicotinic acetylcholine receptors: biogenesis, properties, and diversity.
18691158 2008 Molecular cloning and characterization of a novel human variant of RIC-3, a putative chaperone of nicotinic acetylcholine receptors.
18471073 2008 Functional properties of alpha7 nicotinic acetylcholine receptors co-expressed with RIC-3 in a stable recombinant CHO-K1 cell line.
18246096 2008 RIC-3: a nicotinic acetylcholine receptor chaperone.
18208544 2008 Host-cell specific effects of the nicotinic acetylcholine receptor chaperone RIC-3 revealed by a comparison of human and Drosophila RIC-3 homologues.
18179477 2008 Molecular characterization and localization of the RIC-3 protein, an effector of nicotinic acetylcholine receptor expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17640815 2007 Lack of RIC-3 congruence with beta2 subunit-containing nicotinic acetylcholine receptors in bipolar disorder.
17609200 2007 Differential subcellular localization of RIC-3 isoforms and their role in determining 5-HT3 receptor composition.
17370265 2007 Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry.
17192664 2006 Role of the RIC-3 protein in trafficking of serotonin and nicotinic acetylcholine receptors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16120769 2005 RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells.
15927954 2005 Dual role of the RIC-3 protein in trafficking of serotonin and nicotinic acetylcholine receptors.
15809299 2005 Cell surface expression of 5-hydroxytryptamine type 3 receptors is promoted by RIC-3.
15504725 2005 Ric-3 promotes functional expression of the nicotinic acetylcholine receptor alpha7 subunit in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12821669 2003 Conservation within the RIC-3 gene family. Effectors of mammalian nicotinic acetylcholine receptor expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.