Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.47
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 4.0e-10
nasopharyngeal carcinoma 1058 1.4e-06
chronic rhinosinusitis 512 3.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.235 3.3e-02
ependymoma 2.300 4.0e-10
nasopharyngeal carcinoma -1.200 1.4e-06

 Compartment GO Term (1)

AA Sequence

MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQ      1 - 70
VQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQ     71 - 140
YFSGEDLDRDTRLRMQQGQFRYNLERQQQEQQQAKVDENYTDALSNQLRLAMDAQATHLARLEESCRAAM    141 - 210
MCAMANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPE    211 - 280
QQAAIRKEQEVQRSKKQAHRQAEKTLDTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQQLANEQ    281 - 350
KAQQDYLNSVIYTNQPTAQYHQQFNTSSR                                             351 - 379
//

Text Mined References (8)

PMID Year Title