Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.50
PubTator Score 9.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Oligospermia 30 3.532 1.8
Breast fibroadenoma 8 3.035 1.5

Gene RIF (3)

PMID Text
23682428 PEPP2 has a role in regulating function of membrane and microtubules
21988730 In striking contrast to non-human primates, humans appear to have homogenized their two RHOXF2 copies by the endogenous retrovirus -mediated non-allelic recombination mechanism.
21874235 RHOXF2 is highly expressed in some leukemia cell lines and a variety of human cancers. Results indicate that RHOXF2 is involved in carcinogenesis.

AA Sequence

MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEE      1 - 70
KDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHA     71 - 140
FTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQP    141 - 210
VMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIV    211 - 280
PSFTFPNV                                                                  281 - 288
//

Text Mined References (16)

PMID Year Title
26464818 2015 Upregulation of RHOXF2 and ODF4 Expression in Breast Cancer Tissues.
25780578 2014 RHOXF2 gene, a new candidate gene for spermatogenesis failure.
25416956 2014 A proteome-scale map of the human interactome network.
25292049 2014 Are so-called cancer-testis genes expressed only in testis?
23682428 2012 A likely role for a novel PH-domain containing protein, PEPP2, in connecting membrane and cytoskeleton.
23482336 2013 The RHOX homeobox gene cluster is selectively expressed in human oocytes and male germ cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988730 2011 Rapid evolution and copy number variation of primate RHOXF2, an X-linked homeobox gene involved in male reproduction and possibly brain function.
21874235 2012 Identification of RHOXF2 (PEPP2) as a cancer-promoting gene by expression cloning.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12490318 2002 Two novel human X-linked homeobox genes, hPEPP1 and hPEPP2, selectively expressed in the testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.