Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.21
PubTator Score 15.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.5e-03
atypical teratoid / rhabdoid tumor -1.200 1.6e-06
ductal carcinoma in situ 1.100 1.2e-02
fibroadenoma 1.700 4.8e-02
glioblastoma -1.200 1.7e-05
interstitial cystitis -1.300 2.4e-04
lung adenocarcinoma 1.700 3.7e-04
nasopharyngeal carcinoma -1.100 9.7e-04
non-small cell lung cancer 1.693 5.2e-16

Gene RIF (6)

AA Sequence

MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSV      1 - 70
QVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLL     71 - 140
VGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKA    141 - 210
RLEKKLNAKGVRTLSRCRWKKFFCFV                                                211 - 236
//

Text Mined References (14)

PMID Year Title