Property Summary

NCBI Gene PubMed Count 31
PubMed Score 24.80
PubTator Score 20.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease -1.352 3.4e-02
atypical teratoid/rhabdoid tumor -1.400 7.5e-04
Breast cancer -2.200 1.4e-07
breast carcinoma -1.300 3.9e-25
ependymoma 1.200 7.2e-03
gastric cancer -1.300 5.0e-03
glioblastoma 1.200 7.0e-03
group 4 medulloblastoma -1.400 3.2e-03
hepatocellular carcinoma -1.200 4.6e-05
interstitial cystitis -1.100 1.1e-03
interstitial lung disease -1.100 2.3e-02
invasive ductal carcinoma -1.494 3.3e-03
lung carcinoma -1.600 3.2e-12
medulloblastoma, large-cell 1.300 3.6e-03
mucosa-associated lymphoid tissue lympho... 1.505 2.5e-02
nasopharyngeal carcinoma -1.200 3.4e-03
non-small cell lung cancer -1.794 2.1e-11
osteosarcoma -2.167 9.9e-03
ovarian cancer -2.300 3.4e-04
Pick disease -1.900 6.8e-04
pituitary cancer -2.200 8.6e-03
progressive supranuclear palsy -1.100 4.6e-02
subependymal giant cell astrocytoma -2.285 3.3e-02
tuberculosis and treatment for 3 months 1.200 3.9e-03
ulcerative colitis -2.700 2.1e-08

Gene RIF (15)

AA Sequence

MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYT      1 - 70
TNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVS     71 - 140
EKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKN    141 - 210
LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV                          211 - 258
//

Text Mined References (36)

PMID Year Title