Property Summary

NCBI Gene PubMed Count 28
PubMed Score 26.69
PubTator Score 20.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 2.4e-07
ovarian cancer 8491 2.3e-06
glioblastoma 5572 2.4e-05
tuberculosis 1563 1.3e-04
osteosarcoma 7933 5.1e-04
dermatomyositis 966 9.4e-03

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.258 5.1e-04
glioblastoma -1.300 2.4e-05
tuberculosis 1.100 1.3e-04
ovarian cancer -1.600 2.3e-06
Breast cancer -1.200 2.4e-07
dermatomyositis 1.100 9.4e-03

 GWAS Trait (1)

Gene RIF (13)

PMID Text
26658612 Full-length APC promotes assembly of the Miro-1/Milton-2 complex.
26259702 Miro and Cenp-F promote anterograde mitochondrial movement and proper mitochondrial distribution in daughter cells.
24671417 Data indicate that outer mitochondrial membrane protein Miro1 can stabilize phospho-mutant versions of PARK2 gene (encoding Parkin) on the outer mitochondrial membrane (OMM).
24492963 CXCL12-dependent cell polarization and migration are reduced in Miro-1-silenced cells
24256248 The Miro1-mediated mitochondrial transport in neurons and recently highlighted involvement of Miro1 proteins in mitochondrial turnover, emerging as a key process affected in neurodegeneration.
24092329 Details of a robust association of DISC1 with mitochondrial transport complexes containing TRAK1 and Miro1.
22860091 results indicated that the low-expression levels of RhoT1 and Smad4 were significantly associated with LNM and shorter survival. RhoT1 may be considered as a potential novel marker for predicting the outcome in patients with pancreatic cancer
22078885 Study shows that both PINK1 and Parkin halt mitochondrial movement; PINK1 phosphorylates Miro (1 and 2) and thereby initiates the rapid degradation of Miro through a Parkin- and proteasome-dependent pathway.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19103291 These data suggest that Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons.
19098100 Miro1,2 proteins serve as a [Ca(2+)](c)-sensitive switch and bifunctional regulator for both the motility and fusion-fission dynamics of the mitochondria.
16630562 Moreover, we show that Miro interacts with the Kinesin-binding proteins, GRIF-1 and OIP106, suggesting that the Miro GTPases form a link between the mitochondria and the trafficking apparatus of the microtubules.

AA Sequence

MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQ      1 - 70
EISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTE     71 - 140
IETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLNDAELN    141 - 210
FFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDL    211 - 280
DLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVC    281 - 350
TNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR    351 - 420
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICD    421 - 490
VVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCN    491 - 560
TADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLKQR                561 - 618
//

Text Mined References (34)

PMID Year Title
26658612 2016 APC binds the Miro/Milton motor complex to stimulate transport of mitochondria to the plasma membrane.
26259702 2015 Mitotic redistribution of the mitochondrial network by Miro and Cenp-F.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24995978 2014 Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.
24896179 2014 The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.
24671417 2014 Lysine 27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
24492963 2014 Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256248 2013 Mitochondrial trafficking in neurons and the role of the Miro family of GTPase proteins.
24092329 2014 DISC1 complexes with TRAK1 and Miro1 to modulate anterograde axonal mitochondrial trafficking.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22860091 2012 RhoT1 and Smad4 are correlated with lymph node metastasis and overall survival in pancreatic cancer.
22078885 2011 PINK1 and Parkin target Miro for phosphorylation and degradation to arrest mitochondrial motility.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19528298 2009 HUMMR, a hypoxia- and HIF-1alpha-inducible protein, alters mitochondrial distribution and transport.
19135897 2009 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility.
19103291 2009 GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons.
19098100 2008 Bidirectional Ca2+-dependent control of mitochondrial dynamics by the Miro GTPase.
16630562 2006 The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14521508 2004 Rho GTPases have diverse effects on the organization of the actin filament system.
12696059 2003 Complete physical map and gene content of the human NF1 tumor suppressor region in human and mouse.
12482879 2003 Atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.