Property Summary

NCBI Gene PubMed Count 41
PubMed Score 85.91
PubTator Score 324.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 2.3e-03
psoriasis 1.500 1.6e-03
osteosarcoma -1.839 1.1e-03
atypical teratoid / rhabdoid tumor 1.600 1.8e-03
glioblastoma 1.300 1.7e-05
group 4 medulloblastoma 1.400 1.5e-03
lung cancer -2.700 1.3e-04
breast carcinoma 1.300 1.1e-03
fibroadenoma 1.100 2.0e-02
interstitial cystitis 2.200 2.4e-03
adult high grade glioma 1.200 7.4e-04
primary Sjogren syndrome 1.700 3.0e-04
lung carcinoma -1.100 1.8e-10
ductal carcinoma in situ 1.700 1.3e-02
invasive ductal carcinoma 1.900 2.2e-02
ulcerative colitis 2.300 1.8e-05
ovarian cancer 1.100 2.6e-07

Gene RIF (18)

PMID Text
23850828 Mutations in hematopoiesis-specific Rho GTPases Rac2 and RhoH lead to a wide range of human blood disorders. (Review)
23499578 Our current results indicate differential requirements for RhoH in the development of TCRalphabeta CD8alphaalpha IELs compared to other subsets of T cells including agonist selected T cells.
22850876 RHOH deficiency leads to T cell defects and persistent epidermodysplasia verruciformis-HPV infections.
22689994 conclude that RhoH expression provides a key molecular determinant that allows T cells to switch between sensing chemokine-mediated go signals and TCR-dependent stop signals
22474251 RhoH plays a critical role in prosurvival chronic lymphocytic leukemia cell-cell and cell-microenvironment interactions with this agent.
21473742 Repression of the RHOH gene by JunD
20851766 RhoH is a key adapter protein that maintains LCK in the inactive state, contributing to the regulation of both pre-TCR and TCR signalling during T-cell development.
20738848 propose that RhoH functions as a negative regulator for IL3-induced signals through modulation of the JAK-STAT pathway
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19950172 Data suggest that RhoH function might be regulated by lysosomal degradation of RhoH protein following TCR complex but not BCR activation.
19847197 RhoH has a function in the progression of B-cell chronic lymphocytic leukemia (CLL) in a murine model and show RhoH expression is altered in human primary lymphocytic (CLL) samples.
19414807 RhoH/TTF represents an inducible feedback inhibitor in neutrophils that is involved in the limitation of innate immune responses.
18691253 low expression of the RhoH transcript was a predictor of worse prognosis in both overall and disease-free survival.
18559497 Underexpression of RhoH is associated with Hairy Cell Leukemia
17476282 RHOH mutation is associated with splenic and nodal marginal zone B-cell lymphomas
17443219 Aberrant somatic hypermutation of RhoH gene is associated with diffuse large B cell lymphoma
16541139 In both Richter's transformation and prolymphocytic transformation, high-levels of AID mRNA expression and high-frequency mutations of RhoH protein genes were detected.
15563831 5' end heterogeneity of RhoH mRNAs was observed, due to alternative splicing of some 5' exons and to the use of these different transcription start sites.

AA Sequence

MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRP      1 - 70
LSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQREMGPHRASCVNAMEGKKLA     71 - 140
QDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRRLFSINECKIF                       141 - 191
//

Text Mined References (41)

PMID Year Title
23850828 2013 Hematopoietic-specific Rho GTPases Rac2 and RhoH and human blood disorders.
23499578 2013 Differential requirement for RhoH in development of TCR?? CD8?? IELs and other types of T cells.
22850876 2012 Human RHOH deficiency causes T cell defects and susceptibility to EV-HPV infections.
22689994 2012 Opposing roles for RhoH GTPase during T-cell migration and activation.
22474251 2012 RhoH is critical for cell-microenvironment interactions in chronic lymphocytic leukemia in mice and humans.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21473742 2011 Repression of the RHOH gene by JunD.
21103055 2010 RhoH regulates subcellular localization of ZAP-70 and Lck in T cell receptor signaling.
20851766 2011 RhoH modulates pre-TCR and TCR signalling by regulating LCK.
20738848 2010 The haematopoietic GTPase RhoH modulates IL3 signalling through regulation of STAT activity and IL3 receptor expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20184954 2010 RhoH plays distinct roles in T-cell migrations induced by different doses of SDF1 alpha.
19950172 2010 Lysosomal degradation of RhoH protein upon antigen receptor activation in T but not B cells.
19847197 2010 Involvement of RhoH GTPase in the development of B-cell chronic lymphocytic leukemia.
19414807 2009 RhoH/TTF negatively regulates leukotriene production in neutrophils.
19019431 2009 Aberrant somatic hypermutations in thyroid lymphomas.
18691253 2008 Prognostic implication and biological roles of RhoH in acute myeloid leukaemia.
18559497 2008 Underexpression of RhoH in Hairy Cell Leukemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17476282 2007 Analysis of BCL-6, CD95, PIM1, RHO/TTF and PAX5 mutations in splenic and nodal marginal zone B-cell lymphomas suggests a particular B-cell origin.
17443219 2007 Prognostic analysis of aberrant somatic hypermutation of RhoH gene in diffuse large B cell lymphoma.
17064668 2006 Multiple Rho proteins regulate the subcellular targeting of PAK5.
17035353 2007 Evolution of the Rho family of ras-like GTPases in eukaryotes.
17028588 2006 RhoH GTPase recruits and activates Zap70 required for T cell receptor signaling and thymocyte development.
16965962 2006 Rearrangement of the RHOH gene in a case of splenic lymphoma with villous lymphocytes.
16541139 2006 Richter's and prolymphocytic transformation of chronic lymphocytic leukemia are associated with high mRNA expression of activation-induced cytidine deaminase and aberrant somatic hypermutation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15670823 2005 Bioluminescence resonance energy transfer identify scaffold protein CNK1 interactions in intact cells.
15563831 2004 Structural features of hematopoiesis-specific RhoH/ARHH gene: high diversity of 5'-UTR in different hematopoietic lineages suggests a complex post-transcriptional regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300248 2004 RhoH is required to maintain the integrin LFA-1 in a nonadhesive state on lymphocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809807 2002 The hematopoiesis-specific GTP-binding protein RhoH is GTPase deficient and modulates activities of other Rho GTPases by an inhibitory function.
11460166 2001 Hypermutation of multiple proto-oncogenes in B-cell diffuse large-cell lymphomas.
11368848 2001 Interactions between Rho GTPases and Rho GDP dissociation inhibitor (Rho-GDI).
11032736 2000 cDNA representational difference analysis of human neutrophils stimulated by GM-CSF.
10803463 2000 Nonrandom 4p13 rearrangements of the RhoH/TTF gene, encoding a GTP-binding protein, in non-Hodgkin's lymphoma and multiple myeloma.
9226377 1997 Genomic structure and assignment of the RhoH/TTF small GTPase gene (ARHH) to 4p13 by in situ hybridization.
7784061 1995 TTF, a gene encoding a novel small G protein, fuses to the lymphoma-associated LAZ3 gene by t(3;4) chromosomal translocation.