Property Summary

NCBI Gene PubMed Count 40
PubMed Score 103.98
PubTator Score 74.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.4e-07
psoriasis 6685 1.3e-04
osteosarcoma 7933 2.8e-02
astrocytoma 1493 3.2e-02
Disease Target Count Z-score Confidence
Oral hairy leukoplakia 6 3.252 1.6
Paratyphoid fever 10 3.179 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 2.200 1.3e-04
osteosarcoma -1.125 2.8e-02
astrocytoma 1.100 3.2e-02
ovarian cancer 2.000 1.4e-07

Gene RIF (19)

PMID Text
26746014 This study describes the regulation of EMT in RPE cells by TGF-beta1/miR-124/RHOG signaling and suggests that the supplement of miR-124 exogenously would be a valuable therapeutic approach for the prevention or treatment of proliferative vitreoretinopathy.
24106269 RhoG is expressed and activated in platelets, plays an important role in GPVI-Fc receptor gamma-chain complex-mediated platelet activation, and is critical for thrombus formation in vivo.
22683270 several Rho family small GTPases activate PI3K by an indirect cooperative positive feedback that required a combination of Rac, CDC42, and RhoG small GTPase activities
22383878 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
22251971 The authors show that enteropathogenic Escherichia coli translocates EspH, which inactivates mammalian RhoGEFs and triggers cytotoxicity.
20679435 The activation of RhoG recruits its effector ELMO2 and a Rac GEF Dock4 to form a complex with EphA2 at the tips of cortactin-rich protrusions in migrating breast cancer cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19208761 Results suggest that RhoG is a central target of the Yersinia stratagem and a major upstream regulator of Rac1 during different phases of the Yersinia infection cycle.
17875742 These results identify a new signaling pathway involving RhoG and its exchange factor SGEF downstream from ICAM1 that is critical for leukocyte trans-endothelial migration.
17570359 RhoG protects cells from apoptosis caused by the loss of anchorage through a PI3K-dependent mechanism, independent of its activation of Rac1.
17027967 Taken together, these results suggest that Dock4 plays an important role in the regulation of cell migration through activation of Rac1, and that RhoG is a key upstream regulator for Dock4.
16621998 define RhoG as a critical component of G protein-coupled receptor-stimulated signaling cascades in murine neutrophils
16568096 RhoG is involved in caveolar trafficking. Such translocation is associated with changes in RhoG GDP/GTP levels and is highly dependent on lipid raft integrity and on the function of the GTPase dynamin2.
16339170 Results suggest that RhoG contributes to the regulation of Rac1 activity in migrating cells.
15199069 C-terminal basic tail of RhoG specifically assists the recruitment of the TrioN-PH domain to specific membrane-bound phospholipids
12545154 we show a novel function for the small GTPase RhoG on the regulation of the interferon-gamma promoter and nuclear factor of activated T cells (NFAT) gene. RhoG also promotes T-cell spreading on fibronectin
12376551 RhoG function is mediated by signals independent of Rac1 and Cdc42 activation and instead by direct utilization of a subset of common effectors
10713718 HIV-1 Vpr-expressing Jurkat T cell clones showed a significant upregulation of RhoG expression

AA Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTL      1 - 70
SYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQ     71 - 140
QGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL                       141 - 191
//

Text Mined References (45)

PMID Year Title
26746014 2016 MicroRNA-124 Controls Transforming Growth Factor ?1-Induced Epithelial-Mesenchymal Transition in the Retinal Pigment Epithelium by Targeting RHOG.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24106269 2013 RhoG protein regulates glycoprotein VI-Fc receptor ?-chain complex-mediated platelet activation and thrombus formation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22683270 2012 Cooperative activation of PI3K by Ras and Rho family small GTPases.
22383878 2012 The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity.
22251971 2012 The interplay between the Escherichia coli Rho guanine nucleotide exchange factor effectors and the mammalian RhoGEF inhibitor EspH.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20679435 2010 Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19208761 2009 Yersinia enterocolitica differentially modulates RhoG activity in host cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17875742 2007 RhoG regulates endothelial apical cup assembly downstream from ICAM1 engagement and is involved in leukocyte trans-endothelial migration.
17570359 2007 RhoG regulates anoikis through a phosphatidylinositol 3-kinase-dependent mechanism.
17074883 2006 Differential activation and function of Rho GTPases during Salmonella-host cell interactions.
17027967 2006 Dock4 is regulated by RhoG and promotes Rac-dependent cell migration.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16621998 2006 RhoG regulates the neutrophil NADPH oxidase.
16568096 2006 Involvement of the Rho/Rac family member RhoG in caveolar endocytosis.
16339170 2006 Activation of Rac1 by RhoG regulates cell migration.
16188938 2005 p190 Rho-GTPase activating protein associates with plexins and it is required for semaphorin signalling.
15199069 2004 The C-terminal basic tail of RhoG assists the guanine nucleotide exchange factor trio in binding to phospholipids.
15133129 2004 SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis.
12879077 2003 RhoG activates Rac1 by direct interaction with the Dock180-binding protein Elmo.
12730235 2003 Direct interaction of Rnd1 with Plexin-B1 regulates PDZ-RhoGEF-mediated Rho activation by Plexin-B1 and induces cell contraction in COS-7 cells.
12545154 2003 RhoG regulates gene expression and the actin cytoskeleton in lymphocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
11909943 2002 Critical but distinct roles for the pleckstrin homology and cysteine-rich domains as positive modulators of Vav2 signaling and transformation.
11689693 2001 Kinectin is a key effector of RhoG microtubule-dependent cellular activity.
11604131 2001 Plexin signaling via off-track and rho family GTPases.
10713718 2000 The HIV-1 vpr protein induces anoikis-resistance by modulating cell adhesion process and microfilament system assembly.
10648409 2000 Activation of the small GTPases, rac and cdc42, after ligation of the platelet PAR-1 receptor.
10523675 1999 Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.
9614181 1998 RhoG GTPase controls a pathway that independently activates Rac1 and Cdc42Hs.
9177787 1997 Structure of the human ARHG locus encoding the Rho/Rac-like RhoG GTPase.
8939998 1996 RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.
8464478 1993 Oncogene ect2 is related to regulators of small GTP-binding proteins.
8325658 1993 Localization of ARHG, a member of the RAS homolog gene family, to 11p15.5-11p15.4 by fluorescence in situ hybridization.
1620121 1992 Growth-regulated expression of rhoG, a new member of the ras homolog gene family.