Property Summary

NCBI Gene PubMed Count 35
PubMed Score 147.03
PubTator Score 28.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.3e-08
malignant mesothelioma 3163 5.6e-06
psoriasis 6685 1.2e-03
esophageal adenocarcinoma 737 3.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.900 5.6e-06
esophageal adenocarcinoma -1.400 3.1e-02
psoriasis 1.800 1.2e-03
osteosarcoma 2.249 4.3e-08

 GWAS Trait (1)

Gene RIF (27)

PMID Text
25746724 A novel signaling pathway involving RhoD and its binding partner WHAMM, regulate Golgi dynamics.
24736615 HIV-1 MA-induced upregulation of collagen-I and alpha-SMA expression is dependent on CXCR2 via the Rho/ROCK-1 pathway
24717605 It regulates relaxation of vascular smooth muscle.
24706358 Activated p42/44-MAP kinase, Rho GTPase.
23454120 RhoD interacts with ZIPK in a GTP-dependent manner and modulates stress fiber and focal adhesion reorganization.
23417980 Data from differentiating cultured erythroid precursor cells suggest that RhAG (Rh-associated glycoprotein) knockdown abolishes Rh blood group expression (RhoD; ICAM4 [intercellular adhesion molecule 4]; CD47 Rh-related antigen) in erythroid cells.
23087206 Data show that RhoD binds the actin nucleation-promoting factor WHAMM (WASp homologue associated with actin Golgi membranes and microtubules), as well as the related filamin A-binding protein FILIP1.
22776962 Fetal RHD detection in early pregnancy using a single-exon assay in a routine clinical setting is feasible and accurate after its implementation in an unselected pregnant population.
22665057 A GTPase-deficient mutant of RhoD, RhoDG26V, causes hyperplasia and perturbed differentiation of the epidermis.
22262769 HIV-1 MA-induced upregulation of collagen-I and alpha-SMA expression is dependent on CXCR2 via the Rho/ROCK-1 pathway
22219277 HIV-1 MA-induced upregulation of collagen-I and alpha-SMA expression is dependent on CXCR2 via the Rho/ROCK-1 pathway
20630939 Podocyte BK(Ca) channels are regulated by synaptopodin, Rho, and actin microfilaments.
20528248 Overexpression of RhoD is associated with multiple myeloma.
19826002 estrogen receptor-alpha transcriptional activity is repressed by the Rho/megakaryoblastic leukemia 1 signaling pathway
19682162 The expression of RhoA/Rho kinase mRNA and protein and function in the RA were significantly stronger than in the IMA, suggesting that RhoA/Rho kinase pathway may be one mechanism by which RA is more susceptible to spasm than IMA.
19576212 Data suggest that mammalian cells have two potential steps that require active Rho for the stabilization of midzone microtubules during mitosis and cytokinesis.
19160018 Rho mediates various phenotypes of malignant transformation by Ras and Src through its effectors, ROCK and mDia [review]
18976975 Knockdown of ras homolog family member D (RHOD) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18829532 A previously unknown function of Brk in regulating both RhoA and Ras by phosphorylating p190 and a crucial role of this Brk-elicited signaling pathway in promoting breast malignancy.
18648664 DLC1 negatively regulates Rho/ROCK/MLC2
18552504 strongly activated in HTLV-1 infected T cell lines derived from HAM/TSP patients.
18407999 the the increased expression of p120 isoform 1 during tumor progression contributes to the invasive phenotype of cadherin-deficient carcinomas and that the N-terminal domain of p120 is a valid therapeutic target
17916560 Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain
17342762 The data suggest that Rho-kinase dependent cell contractility contributes to global and local matrix remodeling, whereas Rho dependent activation of mDia and/or other downstream effectors regulates the structure and number of cell processes.
17056591 Galpha13-Rho signaling axis is required for SDF-1-induced migration through CXCR4
17029007 Methylophiopogonanone B appears to induce Rho activation, resulting in actin cytoskeletal reorganization, including dendrite retraction and stress fiber formation.
16651639 These results suggest a critical role for the CS amplitude and the balance between Rac and Rho in mechanochemical regulation of lung EC barrier.

AA Sequence

MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIW      1 - 70
DTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLV     71 - 140
NKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT    141 - 210
//

Text Mined References (39)

PMID Year Title
25746724 2015 RhoD is a Golgi component with a role in anterograde protein transport from the ER to the plasma membrane.
24717605 2014 [Role of the Rho-kinase pathway in pulmonary arterial hypertension].
24706358 2014 Paxillin mediates stretch-induced Rho signaling and endothelial permeability via assembly of paxillin-p42/44MAPK-GEF-H1 complex.
24102721 2013 RhoD binds the Rab5 effector Rabankyrin-5 and has a role in trafficking of the platelet-derived growth factor receptor.
23454120 2013 Interaction of RhoD and ZIP kinase modulates actin filament assembly and focal adhesion dynamics.
23417980 2013 In vitro generated Rh(null) red cells recapitulate the in vivo deficiency: a model for rare blood group phenotypes and erythroid membrane disorders.
23087206 2012 RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules.
22776962 2012 Noninvasive single-exon fetal RHD determination in a routine screening program in early pregnancy.
22665057 2013 RhoD participates in the regulation of cell-cycle progression and centrosome duplication.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20630939 2010 Regulation of podocyte BK(Ca) channels by synaptopodin, Rho, and actin microfilaments.
20528248 2010 Number of expressed cancer/testis antigens identifies focal adhesion pathway genes as possible targets for multiple myeloma therapy.
19826002 2009 Repression of the estrogen receptor-alpha transcriptional activity by the Rho/megakaryoblastic leukemia 1 signaling pathway.
19682162 RhoA/ROK pathway related to the mechanism of higher susceptibility to spasm in RA than in IMA.
19576212 2009 Stabilization of anaphase midzone microtubules is regulated by Rho during cytokinesis in human fibrosarcoma cells.
19160018 2009 Rho signaling, ROCK and mDia1, in transformation, metastasis and invasion.
18829532 2008 Breast tumor kinase phosphorylates p190RhoGAP to regulate rho and ras and promote breast carcinoma growth, migration, and invasion.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18648664 2008 Deleted in liver cancer 1 (DLC1) negatively regulates Rho/ROCK/MLC pathway in hepatocellular carcinoma.
18552504 2008 HTLV-I production based on activation of integrin/ligand signaling in HTLV-I-infected T cell lines derived from HAM/TSP patients.
18407999 2008 A p120 catenin isoform switch affects Rho activity, induces tumor cell invasion, and predicts metastatic disease.
17916560 2007 Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.
17342762 2007 Rho plays a central role in regulating local cell-matrix mechanical interactions in 3D culture.
17064668 2006 Multiple Rho proteins regulate the subcellular targeting of PAK5.
17056591 2006 The Galpha13-Rho signaling axis is required for SDF-1-induced migration through CXCR4.
17029007 2007 A novel agent, methylophiopogonanone B, promotes Rho activation and tubulin depolymerization.
16651639 2006 Differential regulation of pulmonary endothelial monolayer integrity by varying degrees of cyclic stretch.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15187129 2004 The CD40-induced signaling pathway in endothelial cells resulting in the overexpression of vascular endothelial growth factor involves Ras and phosphatidylinositol 3-kinase.
12577064 2003 RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11784792 2002 Antagonistic effects of Rnd1 and RhoD GTPases regulate receptor activity in Semaphorin 3A-induced cytoskeletal collapse.
11484930 2001 Dual function of rhoD in vesicular movement and cell motility.
11350626 2001 Rho proteins: linking signaling with membrane trafficking.
10894936 2000 Assignment of the human RhoHP1 gene (ARHD) to chromosome 11q14.3 by radiation hybrid mapping.
9116026 1997 Isolation of a novel human cDNA (rhoHP1) homologous to rho genes.