Property Summary

NCBI Gene PubMed Count 129
PubMed Score 204.90
PubTator Score 233.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
chronic lymphocytic leukemia 1.039 1.8e-02
malignant mesothelioma -1.600 1.0e-06
astrocytoma 1.200 1.8e-17
glioblastoma 1.700 3.8e-06
osteosarcoma 2.023 8.0e-05
posterior fossa group A ependymoma 1.200 1.5e-09
medulloblastoma, large-cell -1.300 3.8e-03
lung cancer -1.100 4.4e-03
pediatric high grade glioma 1.700 4.0e-08
group 4 medulloblastoma -1.400 1.7e-05
pilocytic astrocytoma 1.800 5.9e-10
subependymal giant cell astrocytoma 1.294 3.8e-02
ovarian cancer 2.100 7.9e-07

Gene RIF (98)

PMID Text
26741994 The knockdown of RhoC protein decreased the proliferation rate of the parental and the IE1-expressing glioblastoma cells.
26260613 we demonstrated that the inactivation of the RHOC/AKT/MAPK pathway was involved in the tumor-suppressive functions of HOXD10 in cholangiocellular carcinoma .
26020100 Smart particles encapsulating the scrambled siRNA sequence did not affect RhoC protein expression.
25933027 Inhibition of ovarian epithelial carcinoma tumorigenesis and progression by miR106b proceeds through the RhoC pathway.
25677806 Depletion of the kinases ROCK1 and ROCK2, two known RhoC downstream effectors, similarly decreases cancer interaction with ECs
25659578 miR-509 has a critical role in brain metastasis of breast cancer by modulating the RhoC-TNF-alpha network.
25649143 MiR-93-5P may inhibit EOC tumorigenesis and progression by targeting RhoC.
25624724 RhoC protein may upregulate VEGF expression, thereby promoting tumor angiogenesis in esophageal squamous cell carcinoma.
25622907 This is the first report in HNSCC demonstrating the role RhoC plays in mediating EGF-stimulated migration and invasion by down-regulating the PI3K-Akt pathway and E-cadherin expression.
25516960 Results identify RhoC as a prominent binding partner of RhoGDI2 and show that RhoGDI2 modulates RhoC activity in cells promoting lung colonization of bladder cancer cells.
25236186 found that miR-10b induced HCC cell invasion and migration by modulating the HOXD10 target gene RhoC, uPAR, MMP-2 and MMP-9 expression
25123151 may contribute to an epithelial-mesenchymal transition and drug resistance in human breast cancer during chemotherapy
24986540 RhoC expression might be involved in epithelial-to-mesenchymal transition of ovarian epithelial carcinoma cells.
24533098 RhoC has a role in regulating cancer stem cells in head and neck squamous cell carcinoma through the over expression of IL-6 and phosphorylation of STAT3
24457551 RhoC/ROCK1 signaling pathways are likely involved in the progression of cervical squamous cell carcinoma
24447566 RhoA, but not RhoC was shown to be essential for the anchored phenotype of breast carcinoma cells that accompanied siRNA-mediated loss of syndecan-2.
24414340 Down-regulation of RhoC expression resulted in decreased migration of neural stem cells.
24376640 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.
24312560 RhoC facilitates tumor cell invasion and promotes subsequent metastasis, in part, by enhancing integrin alpha5beta1 trafficking
24096540 RhoA and RhoC play different, but clear, roles in ERalpha signaling in breast cancer cells.
23993968 The S1P2R specifically activates RhoC via G12/13 proteins and LARG.
23764197 The up-regulated RhoC expression may affect ovarian carcinogenesis and should be considered a good biomarker for the differentiation and progression of ovarian carcinoma
23488932 The different ways in which RhoA, RhoB and RhoC expression is regulated in cancer and how they play distinct roles in cancer progression is discussed.[Review]
23474984 HBx and HBs of hepatitis B virus could increase expression of Ets-1, which consequently contributed to the upregulation of RhoC.
23382905 This study demonstrated the role of RhoC overexpression in malignant transformation of normal human hepatocytes, suggesting that RhoC may function as an oncogene in hepatocytes.
23319595 MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38
23302395 Increased RHOC expression was detected in endometriotic lesions compared to the eutopic endometrium of women with endometriosis and control women.
23145020 RhoC stimulates the proliferation of gastric cancer cells through recruiting IQGAP1 as an effector.
23036489 Knockdown of Hop caused a decrease in the level of RhoC GTPase, and significantly inhibited pseudopodia formation in Hs578T cells. Our data suggest that Hop regulates directional cell migration by multiple unknown mechanisms.
22992742 Data show that the IQ-motif-containing GTPase-activating protein IQGAP1 interacts directly with GTP-bound, prenylated RhoA and RhoC, but not with RhoB.
22935975 Increased prostate RhoC expression predicted a good outcome after radical prostatectomy for high-grade prostate cancer.
22911725 RhoC impacts the metastatic potential and abundance of breast cancer stem cells.
22896661 RhoC GTPase is a substrate for Akt1 and its phosphorylation is absolutely essential for inflammatory breast cancer cell invasion.
22673745 Substitution of RhoC Ile 43 with a Val increased guanine nucleotide exchange factors-catalyzed exchange in vitro.
22293682 Suggest that miR-10b can stimulate the upregulation of RhoC and AKT phosphorylation through targeting HOXD10, thus promoting cell invasion in gastric tumors.
22217540 Data demonstrate that PKN3 physically interacts with Rho-family GTPases, and preferentially with RhoC, a known mediator of tumor invasion and metastasis in epithelial cancers.
22190034 HIV-1 gp160 is identified to have a physical interaction with ras homolog gene family, member C (RHOC) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22057916 miR-493 is a new tumor suppressor miRNA in bladder cancer and inhibits cell motility through downregulation of RhoC and FZD4.
21862636 p38gamma mitogen-activated protein kinase regulates breast cancer cell motility and metastasis, in part, by controlling expression of the metastasis-associated small GTPase RhoC.
21757538 RhoGDIalpha-dependent balance between RhoA and RhoC is a key regulator of cancer cell tumorigenesis
21732343 In a signaling cascade, the loss of E-cadherin activates the transcriptional regulator ETS-1 and consequently leads to the induction of RhoC expression that stabilizes c-Jun in melanoma.
21674277 data suggest that RhoC is a key regulator of cell growth and apoptosis in human hepatocellular carcinoma cells
21576392 RhoC promotes polarized tumor cell migration through FMNL3 by restricting lamellipodial broadening.
21575520 Expression levels of RhoC and ROCK-1 in prostate carcinoma are higher than those in corresponding paracancerous tissues, showing a significant positive correlation with distant metastasis.
21537845 The knockdown of RhoC expression had no effect on the migration-stimulatory activity of IQGAP1.
21242305 Results indicate that SmgGDS is a bona fide GEF that specifically activates RhoA and RhoC through a unique mechanism not used by other Rho family exchange factors.
21208644 RHOC expression may contribute to explain the different stage at diagnosis of clear cell and high-grade serous carcinomas.
21159255 The migration of A549 cell decreased after blockage of PRL-3 and RhoC. PRL-3, RhoC could increase cell migration in A549 cells.
21087931 A p27(kip1)-binding protein, p27RF-Rho, promotes cancer metastasis via activation of RhoA and RhoC.
21079653 RHOC expression was induced by direct p53 binding to a regulatory element within the RHOC gene.
20828398 Recombinant adenovirus mediated RhoA and RhoC shRNA in tandem linked expression may inhibit the growth of human colorectal tumor xenografts in vivo.
20503409 This work shows that RHOC and RHOA play different roles in cell-matrix adhesion, motility, and invasion of MDA-MB-231 and reaffirms the crucial role of RHOC-GTPase in inflammatory breast cancer cell invasion.
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20232393 results suggest that miR-138 plays an important role in TSCC cell migration and invasion by concurrently targeting RhoC and ROCK2, and miR-138 may serve as a novel therapeutic target for TSCC patients at risk of metastatic disease
20101212 a novel regulatory and functional interaction between RhoC and FMNL2 for modulating cell shape and invasiveness and provide mechanistic insight into RhoC-specific signalling events.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20014943 WISP3 and RhoC genes expression status defines a molecular signature of inflammatory breast cancer (IBC).
19953094 In cervical carcinoma cell lines, RhoC contributes to wound healing, invasion & migration, anoikis resistance, colony formation, in vitro tube formation & tumour formation. RhoC is a downstream effector of Notch1.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19861405 Cell motility and invasion were markedly diminished in RhoC-depleted head and neck cell lines.
19701800 LNX and RhoC might be part of a larger protein complex that would have important functions in signaling transduction about regulating the transcriptional activities of AP-1.
19642867 findings demonstrate that enhanced expression of RhoC results in a striking increase in the migration and invasion of pancreatic carcinoma cells, whereas forced expression of RhoA decreases these actions
19499974 The significantly up-regulated RhoC expression suggest that RhoC may contribute to the initiation, development, invasion and metastasis of colorectal carcinoma in Chinese patients.
19477269 Silencing of RhoC expression also leads to a rapid loss of E-cadherin but through proteasomal degradation rather than through reduction in transcription.
19462897 The overexpression of RhoC may play an important role in the invasion and metastasis of squamous carcinoma of cervix.
19421144 MyoGEF cooperates with nonmuscle myosin IIA to regulate the polarity and invasion activity of breast cancer cells through activation of RhoA and RhoC.
19222696 These results further support a role for RhoC in growth and metastasis of melanoma
19157876 This study illustrates that RhoC overexpression and tumor emboli are more frequent in tumors of inflammatory breast cancers relative to non-inflammatory breast cancers in the Egyptian population.
19152186 PRL-3 up-regulates pERK and Rho expression and activity in lung cancer
19107362 RhoC promotes the adhesion, invasion and migration of SiHa cells in vitro, but not proliferation and apoptosis.
19094228 Observational study of gene-disease association. (HuGE Navigator)
19016761 RHOC is essential for angiogenesis induced by hepatocellular carcinoma cells via regulation of endothelial cell organization.
18980974 knockdown of the RhoC expression resulted in inhibition of metastasis of HCC in vivo for the first time.
18794150 Results indicate that RhoC promotes tumor metastasis in prostate cancer by sequential activation of Pyk2, FAK, MAPK, and Akt followed by the up-regulation of MMP2 and MMP9, which results in the stimulation of invasiveness of tumor cells.
18478927 RhoC overexpression may promote the invasive capacity of human breast cancer cells in vitro and its expression level is positively correlated with the metastatic capacity of those cells.
18415097 RhoC may serve as an important and widely applicable target for anti-cancer immunotherapeutic strategies
18211678 We used suppression subtractive hybridization (SSH) to study molecular signature of melanoma progression, by showing characteristics of early neoplastic lesions including expression of KISS1, lack of alphavbeta3-integrin and low levels of RHOC.
18058225 High level of RhoC is associated with breast cancer.
17897917 The antisense RhoC gene can suppress the capacities of proliferation and invasion in a cholangiocarcinoma cell line in vitro.
17896152 High expression of RHOC is associated with esophageal squamous cell carcinoma
17696235 The expression of G3BP and RhoC protein is closely related to the lymph node metastasis and survival in esophageal squamous carcinoma (ESC) patients. G3BP and RhoC proteins can be considered as predictors of prognosis in ESC patients.
17549441 RhoC may play a very important role in the metastasis of gastric carcinoma. Therapeutic strategies targeting RhoC and RhoC-mediated pathways may be a novel approach for treating metastasis of gastric cancer.
17497936 These results suggest that RhoC can undergo at least two conformational transitions during its conversion from a signaling-inactive to a signaling-active state, similar to what has recently been proposed for the H-Ras and M-Ras proteins.
17265125 Findings suggest a strong correlation between the expression of autocrine motility factor receptor (AMFR) and RhoC and a correlation between overexpression of them and metastasis of hepatocellular carcinoma.
17018591 RhoA and RhoC are downstream of PKC epsilon & critical for PKC-epsilon-mediated cell invasion & motility. PKC epsilon coordinately regulates RhoA & RhoC activation, possibly through direct post-translational phosphorylation.
16899593 The RhoC is a specific marker of lymph node metastases in patients form of carcinoma. RhoC levels seem to identify a subset of patients with early tumor stage primary tumors and high metastatic potential that might benefit from more aggressive therapy.
16511001 N-terminal construct of mouse mDia1 was recombinantly expressed in Escherichia coli, purified and crystallized in complex with truncated human RhoC.
15969750 caveolin 1 expression inhibits RhoC GTPase activation and subsequent activation of the p38 MAPK pathway in primary pancreatic cancer cells thus restricting migration and invasion
15668138 siRNAs inhibited cell proliferation and invasion more effectively than conventional blockers of Rho cell signaling
15642170 prenylated proteins (at least RhoA, RhoB and/or RhoC) antagonize the ability of ERalpha and ERbeta to stimulate ERE-dependent transcriptional activity, potentially acting through both AF-1 and AF-2 transcriptional activities
14614010 Higher expression of RhoC is related to invasiveness in non-small cell lung carcinoma
14555841 elevated expression of the RHOC gene may be involved in the metastasis of gastric carcinomas and may be a good genetic marker for the prediction of a metastatic potential
12970882 The RhoC gene may be related to malignant transformation and development of HCC and may play an important role in the invasion and metastasis of HCC by overexpression but not mutation.
12939257 RhoGAP-Rho chimeras specifically down-regulate RhoA, RhoB and RhoC activity and demonstrated that this approach may be applied to multiple human tumor cells to reverse the growth and/or invasion phenotypes associated with a distinct subtype of Rho GTPase
12808121 Up-regulation of this protein is associated with tumor progression in ovarian carcinoma.
12221096 not acted on by XPLN, a guanine nucleotide exchange factor
12090470 Mitogen activated protein kinase pathway is involved in RhoC GTPase induced motility, invasion and angiogenesis in inflammatory breast cancer.
11839578 specifically expressed in invasive breast carcinomas capable of metastasizing

AA Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR      1 - 70
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR     71 - 140
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL                     141 - 193
//

Text Mined References (132)

PMID Year Title
26741994 2016 The Role of RhoA, RhoB and RhoC GTPases in Cell Morphology, Proliferation and Migration in Human Cytomegalovirus (HCMV) Infected Glioblastoma Cells.
26260613 2015 HOXD10 acts as a tumor-suppressive factor via inhibition of the RHOC/AKT/MAPK pathway in human cholangiocellular carcinoma.
26020100 2015 "Smart" Nanoparticles Enhance the Cytoplasmic Delivery of Anti-RhoC Silencing RNA and Inhibit the Migration and Invasion of Aggressive Breast Cancer Cells.
25933027 2015 Inhibition of Ovarian Epithelial Carcinoma Tumorigenesis and Progression by microRNA 106b Mediated through the RhoC Pathway.
25677806 2015 RhoC and ROCKs regulate cancer cell interactions with endothelial cells.
25659578 2015 miR-509 suppresses brain metastasis of breast cancer cells by modulating RhoC and TNF-?.
25649143 2015 RhoC is a major target of microRNA-93-5P in epithelial ovarian carcinoma tumorigenesis and progression.
25624724 2015 RhoC, vascular endothelial growth factor and microvascular density in esophageal squamous cell carcinoma.
25622907 2015 RhoC mediates epidermal growth factor-stimulated migration and invasion in head and neck squamous cell carcinoma.
25516960 2015 RhoC Is an Unexpected Target of RhoGDI2 in Prevention of Lung Colonization of Bladder Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25236186 2014 miR-10b is overexpressed in hepatocellular carcinoma and promotes cell proliferation, migration and invasion through RhoC, uPAR and MMPs.
25123151 2014 RhoC upregulation is correlated with reduced E-cadherin in human breast cancer specimens after chemotherapy and in human breast cancer MCF-7 cells.
24986540 2014 The role of RhoC in epithelial-to-mesenchymal transition of ovarian carcinoma cells.
24533098 2014 RhoC regulates cancer stem cells in head and neck squamous cell carcinoma by overexpressing IL-6 and phosphorylation of STAT3.
24457551 2014 RhoC mediates invasion and migration of CaSki cells through the Rho-associated serine-threonine protein kinase 1 signaling pathway.
24447566 2014 Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.
24414340 2014 RhoC involved in the migration of neural stem/progenitor cells.
24376640 2013 MicroRNA-10b promotes nucleus pulposus cell proliferation through RhoC-Akt pathway by targeting HOXD10 in intervetebral disc degeneration.
24312560 2013 RhoC interacts with integrin ?5?1 and enhances its trafficking in migrating pancreatic carcinoma cells.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
24096540 2013 RhoA and RhoC differentially modulate estrogen receptor ? recruitment, transcriptional activities, and expression in breast cancer cells (MCF-7).
23993968 2013 The activation of RhoC in vascular endothelial cells is required for the S1P receptor type 2-induced inhibition of angiogenesis.
23764197 2013 The role of RhoC in ovarian epithelial carcinoma: a marker for carcinogenesis, progression, prognosis, and target therapy.
23488932 2013 RhoA, RhoB and RhoC have different roles in cancer cell migration.
23474984 2013 HBx and HBs regulate RhoC expression by upregulating transcription factor Ets-1.
23382905 2013 Overexpression of Ras homologous C (RhoC) induces malignant transformation of hepatocytes in vitro and in nude mouse xenografts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23319595 2013 The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion.
23302395 2013 RHOC: a key gene for endometriosis.
23145020 2012 RhoC regulates the proliferation of gastric cancer cells through interaction with IQGAP1.
23036489 2013 Knockdown of Hop downregulates RhoC expression, and decreases pseudopodia formation and migration in cancer cell lines.
22992742 2012 Rho isoform-specific interaction with IQGAP1 promotes breast cancer cell proliferation and migration.
22935975 2012 Utility of RhoC and ZAG protein expression as biomarkers for prediction of PSA failure following radical prostatectomy for high grade prostate cancer.
22911725 2012 RhoC impacts the metastatic potential and abundance of breast cancer stem cells.
22896661 2012 Regulation of inflammatory breast cancer cell invasion through Akt1/PKB? phosphorylation of RhoC GTPase.
22673745 Divergence of Rho residue 43 impacts GEF activity.
22293682 2012 miR-10b promotes cell invasion through RhoC-AKT signaling pathway by targeting HOXD10 in gastric cancer.
22217540 2012 The interaction of PKN3 with RhoC promotes malignant growth.
22057916 2012 Tumor suppressor microRNA-493 decreases cell motility and migration ability in human bladder cancer cells by downregulating RhoC and FZD4.
21862636 2011 p38? promotes breast cancer cell motility and metastasis through regulation of RhoC GTPase, cytoskeletal architecture, and a novel leading edge behavior.
21757538 2011 RhoGDI?-dependent balance between RhoA and RhoC is a key regulator of cancer cell tumorigenesis.
21732343 2012 ETS-1/RhoC signaling regulates the transcription factor c-Jun in melanoma.
21674277 2012 The role of RhoC in the proliferation and apoptosis of hepatocellular carcinoma cells.
21576392 2011 RhoA and RhoC have distinct roles in migration and invasion by acting through different targets.
21575520 2011 [Expression of RhoC and ROCK-1 and their effects on MAPK and Akt proteins in prostate carcinoma].
21537845 RhoC protein stimulates migration of gastric cancer cells through interaction with scaffold protein IQGAP1.
21269460 2011 Initial characterization of the human central proteome.
21242305 2011 SmgGDS is a guanine nucleotide exchange factor that specifically activates RhoA and RhoC.
21208644 2011 Ovarian clear cell carcinomas: RHO GTPases may contribute to explain their singular biologic behavior.
21159255 2010 [Expressions and significances of PRL-3 and RhoC in A549 cell].
21087931 2011 A p27(kip1)-binding protein, p27RF-Rho, promotes cancer metastasis via activation of RhoA and RhoC.
21079653 2011 p53-mediated transcriptional regulation and activation of the actin cytoskeleton regulatory RhoC to LIMK2 signaling pathway promotes cell survival.
20974804 2011 The Rho target PRK2 regulates apical junction formation in human bronchial epithelial cells.
20828398 2010 Silencing of RhoA and RhoC expression by RNA interference suppresses human colorectal carcinoma growth in vivo.
20503409 2010 Characterization of the roles of RHOC and RHOA GTPases in invasion, motility, and matrix adhesion in inflammatory and aggressive breast cancers.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20400958 2010 Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.
20232393 2010 Downregulation of the Rho GTPase signaling pathway is involved in the microRNA-138-mediated inhibition of cell migration and invasion in tongue squamous cell carcinoma.
20101212 2010 Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20014943 2010 Expression of WISP3 and RhoC genes at mRNA and protein levels in inflammatory and noninflammatory breast cancer in Tunisian patients.
19953094 2010 Notch1 regulates the functional contribution of RhoC to cervical carcinoma progression.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19887681 2009 Activation of a bacterial virulence protein by the GTPase RhoA.
19861405 2009 RhoC expression and head and neck cancer metastasis.
19701800 2010 LNX (Ligand of Numb-protein X) interacts with RhoC, both of which regulate AP-1-mediated transcriptional activation.
19642867 2009 Specific induction of migration and invasion of pancreatic carcinoma cells by RhoC, which differs from RhoA in its localisation and activity.
19499974 2009 Expression of RhoA and RhoC in colorectal carcinoma and its relations with clinicopathological parameters.
19477269 2009 Rho isoforms have distinct and specific functions in the process of epithelial to mesenchymal transition in renal proximal tubular cells.
19462897 2009 [The expression of RhoC and Ki67 in cervical intraepithelial neoplasia and squamous carcinoma of cervix].
19421144 2009 Myosin-interacting guanine exchange factor (MyoGEF) regulates the invasion activity of MDA-MB-231 breast cancer cells through activation of RhoA and RhoC.
19222696 2009 The role of RhoC in growth and metastatic capacity of melanoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19157876 2009 Analysis of RhoC expression and lymphovascular emboli in inflammatory vs non-inflammatory breast cancers in Egyptian patients.
19152186 2009 PRL-3 facilitates angiogenesis and metastasis by increasing ERK phosphorylation and up-regulating the levels and activities of Rho-A/C in lung cancer.
19107362 2008 The effect of RhoC siRNA on the invasiveness and proliferation of human cervical cancer cell line SiHa cells.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19016761 2008 RhoC is essential for angiogenesis induced by hepatocellular carcinoma cells via regulation of endothelial cell organization.
18980974 2008 Inhibition of invasion and metastasis of hepatocellular carcinoma cells via targeting RhoC in vitro and in vivo.
18794150 2008 RhoC promotes metastasis via activation of the Pyk2 pathway in prostate cancer.
18478927 2007 [Correlation of expression of RhoC with invasiveness of breast cancer cells in vitro].
18415097 2008 RhoC a new target for therapeutic vaccination against metastatic cancer.
18211678 2008 Suppression subtractive hybridization profiles of radial growth phase and metastatic melanoma cell lines reveal novel potential targets.
18058225 2008 Molecular epidemiologic features of inflammatory breast cancer: a comparison between Egyptian and US patients.
17897917 2007 Antisense RhoC gene suppresses proliferation and invasion capacity of human QBC939 cholangiocarcinoma cells.
17896152 2007 Clinical and prognostic significance of RhoA and RhoC gene expression in esophageal squamous cell carcinoma.
17696235 2007 Expression of G3BP and RhoC in esophageal squamous carcinoma and their effect on prognosis.
17549441 2007 RhoC is essential for the metastasis of gastric cancer.
17497936 2007 X-ray crystal structures reveal two activated states for RhoC.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17265125 2007 Elevated expression of autocrine motility factor receptor correlates with overexpression of RhoC and indicates poor prognosis in hepatocellular carcinoma.
17018591 2006 Targeted disruption of protein kinase C epsilon reduces cell invasion and motility through inactivation of RhoA and RhoC GTPases in head and neck squamous cell carcinoma.
16899593 2006 RhoC GTPase expression as a potential marker of lymph node metastasis in squamous cell carcinomas of the head and neck.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16511001 2005 The purification and crystallization of mDia1 in complex with RhoC.
16236794 2006 Dissecting the role of Rho-mediated signaling in contractile ring formation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15969750 2005 Regulation of pancreatic cancer cell migration and invasion by RhoC GTPase and caveolin-1.
15864301 2005 Structural and mechanistic insights into the interaction between Rho and mammalian Dia.
15670823 2005 Bioluminescence resonance energy transfer identify scaffold protein CNK1 interactions in intact cells.
15668138 2005 Anti-RhoA and anti-RhoC siRNAs inhibit the proliferation and invasiveness of MDA-MB-231 breast cancer cells in vitro and in vivo.
15642170 2005 Prenylation inhibitors stimulate both estrogen receptor alpha transcriptional activity through AF-1 and AF-2 and estrogen receptor beta transcriptional activity.
15501444 2004 Why three Rho proteins? RhoA, RhoB, RhoC, and cell motility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15020670 2004 Rho-family GTPases: it's not only Rac and Rho (and I like it).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614010 2003 Higher expression of RhoC is related to invasiveness in non-small cell lung carcinoma.
14555841 2004 Expression of RHOC is associated with metastasis of gastric carcinomas.
12970882 2003 Expression and significance of RhoC gene in hepatocellular carcinoma.
12939257 2003 A novel strategy for specifically down-regulating individual Rho GTPase activity in tumor cells.
12808121 2003 Up-regulation of small GTPases, RhoA and RhoC, is associated with tumor progression in ovarian carcinoma.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12756732 2003 YopT is a cysteine protease cleaving Rho family GTPases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221096 2002 XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.
11546812 2001 AKAP-Lbc anchors protein kinase A and nucleates Galpha 12-selective Rho-mediated stress fiber formation.
10952316 2000 Genomic analysis of metastasis reveals an essential role for RhoC.
10436159 1999 Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8816443 1996 The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.
8662891 1996 Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.
8617235 1996 The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.
8543060 1995 A novel partner for the GTP-bound forms of rho and rac.
8468062 1993 Reassignment of the human ARH9 RAS-related gene to chromosome 1p13-p21.
7989340 1994 Guanine nucleotide exchange regulates membrane translocation of Rac/Rho GTP-binding proteins.
7835413 1994 Sequence of rho small GTP-binding protein cDNAs from human retina and identification of novel 5' end cloning artifacts.
3888408 1985 A novel ras-related gene family.
3283705 1988 Coding sequence of human rho cDNAs clone 6 and clone 9.
1383236 1992 Intracellular localization of the P21rho proteins.