Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.08
PubTator Score 6.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Gene RIF (5)

PMID Text
26215701 RHOBTB3 serves as a scaffold to organize a multi-subunit complex that promotes the hydroxylation, ubiquitination and degradation of HIFalpha.
24145166 Reveal a novel role for a RhoBTB3 in catalyzing cyclin E turnover during S phase, as well as an unexpected, essential role for the Golgi as a ubiquitylation platform for cell cycle control.
22245496 The interaction between RhoBTB3 and the 5-HT7a receptor strongly inhibits proteasomal degradation of the 5-HT7a receptor.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19490898 Study reports that the atypical Rho GTPase family member, RhoBTB3, binds directly to Rab9 GTPase and functions with Rab9 in protein transport from endosomes to the trans Golgi network.

AA Sequence

MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVV      1 - 70
HDCPVWDIFDSDWYTSRNLIGGADIIVIKYNVNDKFSFHEVKDNYIPVIKRALNSVPVIIAAVGTRQNEE     71 - 140
LPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKR    141 - 210
KMSNSFHGIRPPQLEQPEKMPVLKAEASHYNSDLNNLLFCCQCVDVVFYNPNLKKVVEAHKIVLCAVSHV    211 - 280
FMLLFNVKSPTDIQDSSIIRTTQDLFAINRDTAFPGASHESSGNPPLRVIVKDALFCSCLSDILRFIYSG    281 - 350
AFQWEELEEDIRKKLKDSGDVSNVIEKVKCILKTPGKINCLRNCKTYQARKPLWFYNTSLKFFLNKPMLA    351 - 420
DVVFEIQGTTVPAHRAILVARCEVMAAMFNGNYMEAKSVLIPVYGVSKETFLSFLEYLYTDSCCPAGIFQ    421 - 490
AMCLLICAEMYQVSRLQHICELFIITQLQSMPSRELASMNLDIVDLLKKAKFHHSDCLSTWLLHFIATNY    491 - 560
LIFSQKPEFQDLSVEERSFVEKHRWPSNMYLKQLAEYRKYIHSRKCRCLVM                       561 - 611
//

Text Mined References (18)

PMID Year Title
26215701 2015 RHOBTB3 promotes proteasomal degradation of HIF? through facilitating hydroxylation and suppresses the Warburg effect.
25416956 2014 A proteome-scale map of the human interactome network.
24145166 2013 Golgi-associated RhoBTB3 targets cyclin E for ubiquitylation and promotes cell cycle progression.
22245496 2012 RhoBTB3 interacts with the 5-HT7a receptor and inhibits its proteasomal degradation.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19490898 2009 RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17035353 2007 Evolution of the Rho family of ras-like GTPases in eukaryotes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426103 2002 Genomic organization and expression profile of the small GTPases of the RhoBTB family in human and mouse.
11222756 2001 The Dictyostelium discoideum family of Rho-related proteins.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.