Property Summary

NCBI Gene PubMed Count 33
PubMed Score 53.93
PubTator Score 55.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.200 4.2e-03
osteosarcoma -1.033 2.3e-04
glioblastoma -1.600 2.0e-04
medulloblastoma -1.800 9.4e-07
atypical teratoid / rhabdoid tumor -1.900 3.7e-06
medulloblastoma, large-cell -2.500 3.5e-04
primitive neuroectodermal tumor -1.300 5.9e-03
non-small cell lung cancer -1.708 7.2e-21
lung cancer -1.700 3.0e-04
sarcoidosis -1.300 2.4e-02
adult high grade glioma -1.600 2.0e-03
lung adenocarcinoma -1.700 8.4e-08
lung carcinoma -1.100 1.0e-14

Gene RIF (23)

PMID Text
24608665 data suggest a new paradigm for Hsp90-modulated assembly of a Cul3/DBC2 E3 ubiquitin ligase complex that may extend to other E3 ligase complexes.
24485767 Mutation in the promoter and exon 7 of DBC2 gene is not common in the Chinese population and may not contribute to the susceptibility for breast cancer in China
24356943 ). The results demonstrated that aberrant methylation of RhoBTB2 may be responsible for the suppression of RhoBTB2 mRNA expression in breast cancer, a significant event during the genesis of breast cancer that correlated with progesterone receptor status
23546941 Thus loss of DBC2 expression is caused by abnormal methylation of DBC2 and might have a role in breast cancer development.
22901165 Loss of DBC2 expression is an early and progressive event in the development of lung adenocarcinoma.
21801820 Overexpression of RhoBTB2 in breast tumor cells significantly inhibited the proliferation and colony formation of tumor cells. In addition, RhoBTB2 also elevated the apoptotic ratio and caused typical changes of apoptotic morphology.
20980811 RhoBTB2 is establishing itself as a tumor suppressor with increasing relevance towards malignancies.
20930524 Ectopic expression of RhoBTB2 results in decreased phosphorylation of ezrin and Akt2 in both MDA-MB-231 and MDA-MB-435 cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19937980 Frequent loss of RhoBTB2 expression is associated with sporadic breast cancer.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19173804 The expression of Fas, CTLA-4 and RhoBTB2 at the mRNA level is involved in genesis and progression of breast cancer.
18762809 CXCL14 is a gene target of RhoBTB2 and supports downregulation of CXCL14 as a functional outcome of RhoBTB2 loss in cancer.
18640857 aberrant methylation in DBC2 promoter may be responsible for the expression loss of DBC2 expression in bladder cancer and this hypermethylation event could play a crucial role in the early stage of bladder tumorigenesis.
18039672 RhoBTB2 up-regulated during drug-induced apoptosis, with this being primarily dependent on E2F1.
17906984 Mutations & allelic loss in the DBC2 gene are uncommon in gastric cancers in Korean patients, so it is unlikely to play a major role. 3 new polymorphisms in the coding region were found.
17653899 The researchers isolated three novel mutations in the DBC2 gene in breast cancer families in Iran.
17617377 These findings indicate that the resistant T-47D cells survive DBC2 induction by rapid destruction of DBC2 through 26S proteasome-mediated protein degradation.
17517369 Our results indicate that the down-regulation of CCND1 is an essential step for DBC2's growth suppression of cancer cells.
17023000 DBC2 plays an essential role in microtubule-mediated VSVG transport from the endoplasmic reticulum to the Golgi apparatus.
15663929 two networks were found to react substantially to DBC2 expression--one of the networks regulates cell growth through cell-cycle control and apoptosis; the other network is related to cytoskeleton and membrane trafficking
12370419 A previously uncharacterized gene, DBC2 (deleted in breast cancer), was cloned from a homozygously deleted region at human chromosome 8p21.

AA Sequence

MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQEVLERSR      1 - 70
DVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGC     71 - 140
QLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALIS    141 - 210
RRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFA    211 - 280
HKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCES    281 - 350
VDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSS    351 - 420
IQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRV    421 - 490
KECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYT    491 - 560
GMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADW    561 - 630
CLHHICTNYNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQPKRR    631 - 700
WLFWNSPSSPSSSAASSSSPSSSSAVV                                               701 - 727
//

Text Mined References (34)

PMID Year Title
24608665 2014 Hsp90-dependent assembly of the DBC2/RhoBTB2-Cullin3 E3-ligase complex.
24485767 2014 The mutation of DBC2 in breast cancer patients from the Han ethnic group in Eastern China.
24356943 2014 RhoBTB2 gene in breast cancer is silenced by promoter methylation.
23546941 2013 Decreased expression of the DBC2 gene and its clinicopathological significance in breast cancer: correlation with aberrant DNA methylation.
22901165 2012 Loss of DBC2 expression is an early and progressive event in the development of lung adenocarcinoma.
21801820 2011 RhoBTB2 (DBC2) functions as tumor suppressor via inhibiting proliferation, preventing colony formation and inducing apoptosis in breast cancer cells.
20980811 2010 RhoBTB2 (DBC2) comes of age as a multifunctional tumor suppressor.
20930524 2010 Ectopic expression of RhoBTB2 inhibits migration and invasion of human breast cancer cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19937980 2010 A novel tumor suppressor gene RhoBTB2 (DBC2): frequent loss of expression in sporadic breast cancer.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19173804 2008 [Expressions of Fas, CTLA-4 and RhoBTB2 genes in breast carcinoma and their relationship with clinicopathological factors].
18762809 2008 The atypical Rho GTPase RhoBTB2 is required for expression of the chemokine CXCL14 in normal and cancerous epithelial cells.
18640857 DBC2 gene is silenced by promoter methylation in bladder cancer.
18039672 2008 RhoBTB2 (DBC2) is a mitotic E2F1 target gene with a novel role in apoptosis.
17906984 2008 Genetic analysis of the DBC2 gene in gastric cancer.
17653899 2007 Mutation analysis of the DBC2 gene in sporadic and familial breast cancer.
17617377 2007 DBC2 resistance is achieved by enhancing 26S proteasome-mediated protein degradation.
17517369 2007 Cyclin D1 down-regulation is essential for DBC2's tumor suppressor function.
17023000 2006 DBC2 is essential for transporting vesicular stomatitis virus glycoprotein.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15663929 2005 DBC2 significantly influences cell-cycle, apoptosis, cytoskeleton and membrane-trafficking pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107402 2004 RhoBTB2 is a substrate of the mammalian Cul3 ubiquitin ligase complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426103 2002 Genomic organization and expression profile of the small GTPases of the RhoBTB family in human and mouse.
12370419 2002 DBC2, a candidate for a tumor suppressor gene involved in breast cancer.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11222756 2001 The Dictyostelium discoideum family of Rho-related proteins.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.