Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.47
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy -1.219 5.9e-04
cystic fibrosis -1.489 2.5e-05
ependymoma 1.500 4.3e-07
esophageal adenocarcinoma 1.300 2.0e-02
gastric cancer 1.400 5.8e-03
group 4 medulloblastoma 1.200 4.9e-02
hepatocellular carcinoma 1.100 2.5e-02
intraductal papillary-mucinous adenoma (... 2.500 4.5e-04
lung cancer 2.300 9.6e-04
lung carcinoma -1.400 1.1e-14
ovarian cancer -1.700 7.0e-07
pancreatic cancer 2.200 2.5e-04
pancreatic carcinoma 2.200 2.5e-04
psoriasis -1.300 6.7e-09
subependymal giant cell astrocytoma 1.624 4.9e-02

Synonym

Accession O94844
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSR      1 - 70
DVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGC     71 - 140
QLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIRAALIS    141 - 210
RRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFA    211 - 280
HRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSN    281 - 350
KSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYT    351 - 420
GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFSDVTFK    421 - 490
LDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVLDYLYTKQLSPNLDLDPLELI    491 - 560
ALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSYLELAQFHNAHQLAAWCLHHICTNYNSVCSK    561 - 630
FRKEIKSKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA        631 - 696
//

Text Mined References (13)

PMID Year Title