Property Summary

NCBI Gene PubMed Count 774
PubMed Score 3332.73
PubTator Score 1649.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 2.1
Disease Target Count Z-score Confidence
Cancer 2499 5.726 2.9

Expression

  Differential Expression (13)

Disease log2 FC p
diabetes mellitus 1.800 1.4e-03
acute quadriplegic myopathy 1.203 1.1e-07
ependymoma 1.100 4.2e-06
lung carcinoma -1.200 8.2e-10
mucosa-associated lymphoid tissue lympho... 1.302 2.0e-02
Multiple myeloma 1.779 4.7e-04
osteosarcoma 1.283 7.5e-04
ovarian cancer -1.900 4.4e-09
pancreatic cancer -1.100 3.0e-04
pancreatic carcinoma -1.100 3.0e-04
primary pancreatic ductal adenocarcinoma 1.863 6.3e-05
Rheumatoid arthritis -1.200 4.3e-02
Waldenstrons macroglobulinemia 1.142 2.9e-02

Gene RIF (640)

AA Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR      1 - 70
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK     71 - 140
PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL                     141 - 193
//

Text Mined References (789)

PMID Year Title