Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.54
PubTator Score 4.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 7.7e-03
ependymoma -1.700 3.6e-02
oligodendroglioma -1.900 8.9e-03
medulloblastoma -2.200 1.7e-07
atypical teratoid / rhabdoid tumor -2.000 7.2e-07
glioblastoma -1.600 1.5e-03
medulloblastoma, large-cell -2.300 1.2e-04
primitive neuroectodermal tumor -1.800 7.7e-04
adult high grade glioma -1.400 9.8e-03
pilocytic astrocytoma -1.500 2.2e-04
ovarian cancer 1.300 1.4e-11

Gene RIF (5)

PMID Text
25422319 These results establish CAD as a downstream effector of Rheb and suggest a possible role of Rheb in regulating de novo pyrimidine nucleotide synthesis.(Rheb small GTPases, which consist of Rheb1 and Rheb2 (also known as RhebL1)
24127550 Findings are unprecedented and indicate that the DHH-RHEBL1 fusion transcript is a novel recurrent feature in the changing landscape of CBFA2T3-GLIS2-positive childhood AML.
21655954 RhebL1 may be impacting the mTOR pathway in a different manner than Rheb1.
16328882 RHEBL1 is a positive regulator of NF-kappa B-mediated gene transcription.
16098514 Data show that Rheb like-1 protein (RhebL1) rescues mTOR signaling during nutrient withdrawal, and identify critical residues in Rheb and RhebL1 which are required for their efficient activation of mTOR signaling.

AA Sequence

MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQDEYSIL      1 - 70
PYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRVPVVLVGNKADLSPEREVQAVEGKKLAES     71 - 140
WGATFMESSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM                               141 - 183
//

Text Mined References (14)

PMID Year Title
25422319 2015 Rheb protein binds CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamoylase, and dihydroorotase) protein in a GTP- and effector domain-dependent manner and influences its cellular localization and carbamoyl-phosphate synthetase (CPSase) activity.
25416956 2014 A proteome-scale map of the human interactome network.
24127550 2013 DHH-RHEBL1 fusion transcript: a novel recurrent feature in the new landscape of pediatric CBFA2T3-GLIS2-positive acute myeloid leukemia.
21655954 2012 Effects of RhebL1 silencing on the mTOR pathway.
17162089 2007 Activation of the mTOR signaling pathway in renal clear cell carcinoma.
16328882 2005 Identification and characterization of RHEBL1, a novel member of Ras family, which activates transcriptional activities of NF-kappa B.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16098514 2005 Analysis of mTOR signaling by the small G-proteins, Rheb and RhebL1.
16006564 2005 The farnesyl transferase inhibitor (FTI) SCH66336 (lonafarnib) inhibits Rheb farnesylation and mTOR signaling. Role in FTI enhancement of taxane and tamoxifen anti-tumor activity.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12869548 2003 Identification of dominant negative mutants of Rheb GTPase and their use to implicate the involvement of human Rheb in the activation of p70S6K.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.