Property Summary

NCBI Gene PubMed Count 93
PubMed Score 207.12
PubTator Score 134.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Disease Target Count
non-small cell lung carcinoma 317
Disease Target Count P-value
adult high grade glioma 3801 5.3e-03
group 3 medulloblastoma 4104 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.300 5.3e-03
group 3 medulloblastoma 1.200 4.0e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (64)

AA Sequence

MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIF      1 - 70
PQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAES     71 - 140
WNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM                              141 - 184
//

Text Mined References (97)

PMID Year Title