Property Summary

NCBI Gene PubMed Count 147
PubMed Score 685.77
PubTator Score 1215.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 4.2e-05
mucosa-associated lymphoid tissue lympho... 2.460 1.3e-02
osteosarcoma -6.774 2.0e-14
psoriasis -2.600 1.2e-05

Gene RIF (107)

AA Sequence

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFR      1 - 70
RHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLV     71 - 140
VMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAM    141 - 210
LGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVA    211 - 280
VGTSCHLIPSPWLAMVLGLVAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLD    281 - 350
TVGAGNGMIGFQVLLSIGELSLAIVIALMSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF       351 - 417
//

Text Mined References (149)

PMID Year Title