Property Summary

NCBI Gene PubMed Count 30
PubMed Score 43.32
PubTator Score 28.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 5.1e-05
Disease Target Count Z-score Confidence
Metabolic acidosis 49 4.633 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.172 5.1e-05

Gene RIF (13)

PMID Text
26029888 RHBG expression as a direct target of beta-catenin regulation.
25616663 Kidney AE1 actually associates with epithelial ankyrin-G and renal ammonium transporter RhBG, which also binds ankyrin-G.
24647713 Rh B Glycoprotein (Rhbg) and Rh C Glycoprotein (Rhcg) are identified as ammonia transporters. They are expressed in specific cell populations and membrane domains in distal renal epithelial cells, where they facilitate ammonia secretion.
24077989 RhAG, RhBG and RhCG-exhibit significant permeability to NH3 and show for the first time that RhBG and RhCG can conduct CO2.
23324176 human kidney expresses basolateral RhBG protein in connecting segment, type A intercalated cells, and non-A, non-B cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19429772 Rhbg and Rhcg may contribute to bronchial epithelial cell ammonia metabolism and suggest that they do not contribute to pulmonary carbon dioxide transport.
19357182 This study concludes that under normal conditions, RhCG is the major putative ammonia transporter expressed in the human kidney and RhBG is not expressed at detectable levels.
18635543 Phosphorylation and ankyrin-G binding of the C-terminal domain regulate targeting and function of the ammonium transporter RhBG
15929723 RhBG and RhCG facilitate ammonium movement across the plasma membrane; these results favor the hypothesis that these Rh glycoproteins, together with their homolog RhAG, constitute a family of NH3 channels in mammalian cells.
15611082 RhBG requires a tyrosine-based signal and ankyrin-G for basolateral targeting and membrane
15284342 Electric current measurements and intracellular pHi determinations suggest that RhBG acts as an electroneutral NH4+-H+ exchanger.

AA Sequence

MAGSPSRAAGRRLQLPLLCLFLQGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAM      1 - 70
VFVGFGFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIHVGVESMINADFCAGAVLISF     71 - 140
GAVLGKTGPTQLLLMALLEVVLFGINEFVLLHLLGVRDAGGSMTIHTFGAYFGLVLSRVLYRPQLEKSKH    141 - 210
RQGSVYHSDLFAMIGTIFLWIFWPSFNAALTALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDM    211 - 280
VHIQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGV    281 - 350
LGALLGVLVAGLATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFL    351 - 420
DSPPRLPALRGPSSLAGAWRA                                                     421 - 441
//

Text Mined References (30)

PMID Year Title
26029888 2015 Wnt/?-Catenin Signaling Regulates the Expression of the Ammonium Permease Gene RHBG in Human Cancer Cells.
25616663 2015 Evidence of a structural and functional ammonium transporter RhBG·anion exchanger 1·ankyrin-G complex in kidney epithelial cells.
24647713 2014 Ammonia transport in the kidney by Rhesus glycoproteins.
24077989 2013 Relative CO?/NH? permeabilities of human RhAG, RhBG and RhCG.
23324176 2013 Expression of the ammonia transporter family member, Rh B Glycoprotein, in the human kidney.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20539225 2010 Molecular physiology of the Rh ammonia transport proteins.
19953292 2010 The Rh protein family: gene evolution, membrane biology, and disease association.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19429772 2009 Expression of the gas-transporting proteins, Rh B glycoprotein and Rh C glycoprotein, in the murine lung.
19357182 2009 RhCG is the major putative ammonia transporter expressed in the human kidney, and RhBG is not expressed at detectable levels.
18635543 2008 Phosphorylation and ankyrin-G binding of the C-terminal domain regulate targeting and function of the ammonium transporter RhBG.
18032481 2008 Ammonium transport in the colonic crypt cell line, T84: role for Rhesus glycoproteins and NKCC1.
17106214 2007 Ammonium homeostasis and human Rhesus glycoproteins.
16764738 2006 Molecular biology of Rh proteins and relevance to molecular medicine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16584906 Hydrophobic cluster analysis and modeling of the human Rh protein three-dimensional structures.
16281947 2005 Modelling the human rhesus proteins: implications for structure and function.
16227429 2005 Evolutionary conservation and diversification of Rh family genes and proteins.
15929723 2005 Human Rhesus B and Rhesus C glycoproteins: properties of facilitated ammonium transport in recombinant kidney cells.
15611082 2005 The ammonium transporter RhBG: requirement of a tyrosine-based signal and ankyrin-G for basolateral targeting and membrane anchorage in polarized kidney epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284342 2004 Electroneutral ammonium transport by basolateral rhesus B glycoprotein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12595489 2003 RhBG and RhCG, the putative ammonia transporters, are expressed in the same cells in the distal nephron.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11358367 New insights into the Rh superfamily of genes and proteins in erythroid cells and nonerythroid tissues.
11024028 2001 Rh type B glycoprotein is a new member of the Rh superfamily and a putative ammonia transporter in mammals.
10852913 2000 Characterization of human RhCG and mouse Rhcg as novel nonerythroid Rh glycoprotein homologues predominantly expressed in kidney and testis.