Property Summary

NCBI Gene PubMed Count 16
PubMed Score 23.55
PubTator Score 11.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.600 8.3e-05
glioblastoma 1.100 1.3e-04
pancreatic ductal adenocarcinoma liver m... 1.272 4.5e-02
active ulcerative colitis 1.694 1.1e-02
pilocytic astrocytoma 1.600 5.4e-08

Pathway (1)

Gene RIF (8)

PMID Text
26535007 results explain how loss of the amino terminus in iRhom1 and iRhom2 impairs TNF signaling, despite enhancing ADAM17 activity
26109405 The expression of iRhom1 was increased by endoplasmic reticulum (ER) stressors, such as thapsigargin and tunicamycin, leading to the enhancement of proteasome activity, especially in ER-containing microsomes.
24648344 RHBDF1 is a critical component of a molecular switch that regulates HIF1alpha stability in cancer cells in hypoxia.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18832597 RHBDF1 is critically involved in a G protein-coupled receptors ligand-stimulated process leading to the activation of latent epidermal growth factor receptor ligands
18524845 RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
15965977 RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface

AA Sequence

MSEARRDSTSSLQRKKPPWLKLDIPSAVPLTAEEPSFLQPLRRQAFLRSVSMPAETAHISSPHHELRRPV      1 - 70
LQRQTSITQTIRRGTADWFGVSKDSDSTQKWQRKSIRHCSQRYGKLKPQVLRELDLPSQDNVSLTSTETP     71 - 140
PPLYVGPCQLGMQKIIDPLARGRAFRVADDTAEGLSAPHTPVTPGAASLCSFSSSRSGFHRLPRRRKRES    141 - 210
VAKMSFRAAAALMKGRSVRDGTFRRAQRRSFTPASFLEEDTTDFPDELDTSFFAREGILHEELSTYPDEV    211 - 280
FESPSEAALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVRLRQEVVSTAGP    281 - 350
RRGQRIAVPVRKLFAREKRPYGLGMVGRLTNRTYRKRIDSFVKRQIEDMDDHRPFFTYWLTFVHSLVTIL    351 - 420
AVCIYGIAPVGFSQHETVDSVLRNRGVYENVKYVQQENFWIGPSSEALIHLGAKFSPCMRQDPQVHSFIR    421 - 490
SAREREKHSACCVRNDRSGCVQTSEEECSSTLAVWVKWPIHPSAPELAGHKRQFGSVCHQDPRVCDEPSS    491 - 560
EDPHEWPEDITKWPICTKNSAGNHTNHPHMDCVITGRPCCIGTKGRCEITSREYCDFMRGYFHEEATLCS    561 - 630
QVHCMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSG    631 - 700
VTGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNF    701 - 770
AHISGFISGLFLSFAFLPYISFGKFDLYRKRCQIIIFQVVFLGLLAGLVVLFYVYPVRCEWCEFLTCIPF    771 - 840
TDKFCEKYELDAQLH                                                           841 - 855
//

Text Mined References (20)

PMID Year Title
26535007 2015 Deletions in the cytoplasmic domain of iRhom1 and iRhom2 promote shedding of the TNF receptor by the protease ADAM17.
26109405 2015 iRhom1 regulates proteasome activity via PAC1/2 under ER stress.
24648344 2014 Human rhomboid family-1 suppresses oxygen-independent degradation of hypoxia-inducible factor-1? in breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21439629 2011 Rhomboid family pseudoproteases use the ER quality control machinery to regulate intercellular signaling.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18832597 2009 Human rhomboid family-1 gene RHBDF1 participates in GPCR-mediated transactivation of EGFR growth signals in head and neck squamous cancer cells.
18524845 2008 Human rhomboid family-1 gene silencing causes apoptosis or autophagy to epithelial cancer cells and inhibits xenograft tumor growth.
16728641 2006 A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter.
16341674 2005 Transcriptome analysis of human gastric cancer.
15965977 2005 Characterization of a human rhomboid homolog, p100hRho/RHBDF1, which interacts with TGF-alpha family ligands.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
9054936 1997 The relationship between chromosome structure and function at a human telomeric region.
8318735 1993 Homology of a 130-kb region enclosing the alpha-globin gene cluster, the alpha-locus controlling region, and two non-globin genes in human and mouse.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.