Property Summary

NCBI Gene PubMed Count 44
PubMed Score 1008.10
PubTator Score 324.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -6.769 1.5e-12
medulloblastoma, large-cell 1.200 3.4e-05
mucosa-associated lymphoid tissue lympho... 2.351 2.4e-02
psoriasis -1.500 6.0e-11

Gene RIF (22)

PMID Text
26354748 We characterized ammonia and ammonium (NH3/NH4 (+)) transport by the rhesus-associated (Rh) glycoproteins RhAG, Rhbg, and Rhcg expressed in Xenopus oocytes. We used ion-selective microelectrodes and two-electrode voltage clamp to measure changes in intracellular pH, surface pH, and whole cell currents induced by NH3/NH4 (+) and methyl amine/ammonium (MA/MA(+)).
26175207 novel allele in a Brazilian pregnant woman encoding the Rhnull phenotype due to a change in RHAG exon2 c.310C>T, which leads to a premature stop codon (Gln104Stop).
25296744 A new Rh null allele (RHAG*01N.13) of the regulator type found in a consanguineous French-speaking quebecers'family.
24077989 RhAG, RhBG and RhCG-exhibit significant permeability to NH3 and show for the first time that RhBG and RhCG can conduct CO2.
23417980 Data from differentiating cultured erythroid precursor cells suggest that RhAG knockdown abolishes Rh blood group expression (RhoD [ras homolog family member D]; ICAM4 [intercellular adhesion molecule 4]; CD47 Rh-related antigen) in erythroid cells.
22012326 Results provide new insights into the functional impact of the Phe65Ser mutation in RhAG.
21883272 Substitution of GPB with Gp.Mur significantly reduced the expression of Rh antigen and RhAG on the Mi.III(+/+) erythrocyte membrane
21849667 The results provide new insight into RhAG stomatocytosis mutant F65S as a combined loss-of-function/gain-of-function mutation for methylammonium/methylammonium+ transport
21682734 that the 672C>A missense mutation in the RHAG gene could result in Rh(null) of the regulator type, and the single-amino-acid change (Ser to Arg) might be critical for assembly of the Rh antigen complex within the membrane
19273840 gas channels exhibit selectivity for CO(2) vs. NH(3) permeability, demonstrating the sequence AQP4 congruent with AQP5 > AQP1 > AmtB > RhAG.
18931342 Reduced amounts of Rh-associated glycoprotein is associated with overhydrated hereditary stomatocytosis.
17712059 Rh protein, presumably the Rh-associated glycoprotein RhAG, possesses a gas channel that allows passage of CO2 in addition to NH3
16574458 Review. RhAG plays a major role in the NH3 conductance of erythrocytes, but probably not in CO2 transport.
16564724 RhAG expression enhanced the ammonium-induced initial alkalinization (related to NH3 influx)& secondary acidification (related to NH4+ influx). Sub-millimolar NH4+ concentrations induced inward currents in voltage-clamped RhAG-expressing cells.
16563829 RhAG-mediated transport is an electroneutral process that is driven by the NH4+ concentration and the transmembrane H+ gradient, effectively exchanging NH4+ for H+ in a process that results in transport of net NH3.
16378686 Observational study of gene-disease association. (HuGE Navigator)
16378686 The combination of these polymorphisms could not be found in any control individuals, suggesting that they might be involved in genetic predisposition to migraine in this family.
15572441 RhAG facilitates CH(3)NH(2)/NH(3) movement across the RBC membrane and represents a potential example of a gas channel in mammalian cells.
14966114 RhAG functions as a NH(4)(+)/H(+) exchanger; ammonium transport is coupled to the H(+) gradient
12393442 interactions of CD47 and RhAG and the Rh proteins with one another and with the cytoskeleton of intact erythrocytes
12130520 Cell-surface expression of RhD blood group polypeptide is posttranscriptionally regulated by the RhAG glycoprotein.
11861637 identification as a mammalian ammonium transporter

AA Sequence

MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMT      1 - 70
FLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQ     71 - 140
MLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLF    141 - 210
AMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGG    211 - 280
VAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVA    281 - 350
MGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR               351 - 409
//

Text Mined References (47)

PMID Year Title
26354748 2015 Mechanisms of ammonia and ammonium transport by rhesus-associated glycoproteins.
26175207 2015 Novel RHAG allele encoding the Rh(null) phenotype in Brazil.
25296744 2015 A new Rhnull allele in francophone Quebecers.
24077989 2013 Relative CO?/NH? permeabilities of human RhAG, RhBG and RhCG.
23417980 2013 In vitro generated Rh(null) red cells recapitulate the in vivo deficiency: a model for rare blood group phenotypes and erythroid membrane disorders.
22012326 2012 Human RhAG ammonia channel is impaired by the Phe65Ser mutation in overhydrated stomatocytic red cells.
21883272 2012 Expression of the Rh/RhAG complex is reduced in Mi.III erythrocytes.
21849667 2011 Loss-of-function and gain-of-function phenotypes of stomatocytosis mutant RhAG F65S.
21682734 2011 A family study of the Chinese Rhnull individual of the regulator type: a novel single missense mutation identified in RHAG gene.
19744193 2010 A new blood group system, RHAG: three antigens resulting from amino acid substitutions in the Rh-associated glycoprotein.
19273840 2009 Relative CO2/NH3 selectivities of AQP1, AQP4, AQP5, AmtB, and RhAG.
18931342 2009 The monovalent cation leak in overhydrated stomatocytic red blood cells results from amino acid substitutions in the Rh-associated glycoprotein.
17712059 2008 RhAG protein of the Rhesus complex is a CO2 channel in the human red cell membrane.
16866382 2006 Rapid exchange of fluoroethylamine via the Rhesus complex in human erythrocytes: 19F NMR magnetization transfer analysis showing competition by ammonia and ammonia analogues.
16580865 Functional interaction between Rh proteins and the spectrin-based skeleton in erythroid and epithelial cells.
16574458 Role of RhAG and AQP1 in NH3 and CO2 gas transport in red cell ghosts: a stopped-flow analysis.
16564724 The challenge of understanding ammonium homeostasis and the role of the Rh glycoproteins.
16563829 Transport characteristics of mammalian Rh and Rh glycoproteins expressed in heterologous systems.
16378686 2006 Exclusion of the juvenile myoclonic epilepsy gene EFHC1 as the cause of migraine on chromosome 6, but association to two rare polymorphisms in MEP1A and RHAG.
16227429 2005 Evolutionary conservation and diversification of Rh family genes and proteins.
15929723 2005 Human Rhesus B and Rhesus C glycoproteins: properties of facilitated ammonium transport in recombinant kidney cells.
15856280 2005 Expression of the human erythroid Rh glycoprotein (RhAG) enhances both NH3 and NH4+ transport in HeLa cells.
15572441 2004 Human Rhesus-associated glycoprotein mediates facilitated transport of NH(3) into red blood cells.
14966114 2004 Mechanism of genetic complementation of ammonium transport in yeast by human erythrocyte Rh-associated glycoprotein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12846905 2003 The Rh complex exports ammonium from human red blood cells.
12719424 2003 Rh-RhAG/ankyrin-R, a new interaction site between the membrane bilayer and the red cell skeleton, is impaired by Rh(null)-associated mutation.
12531814 2003 A band 3-based macrocomplex of integral and peripheral proteins in the RBC membrane.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393442 2003 Fractional attachment of CD47 (IAP) to the erythrocyte cytoskeleton and visual colocalization with Rh protein complexes.
12204676 2002 RhCG is downregulated in oesophageal squamous cell carcinomas, but expressed in multiple squamous epithelia.
12130520 2002 Cell-surface expression of RhD blood group polypeptide is posttranscriptionally regulated by the RhAG glycoprotein.
11861637 2002 Identification of the erythrocyte Rh blood group glycoprotein as a mammalian ammonium transporter.
11062476 2000 The human Rhesus-associated RhAG protein and a kidney homologue promote ammonium transport in yeast.
10862620 2000 Cloning and characterization of erythroid-specific DNase I-hypersensitive site in human rhesus-associated glycoprotein gene.
10467273 1999 Molecular basis for Rh(null) syndrome: identification of three new missense mutations in the Rh50 glycoprotein gene.
9915949 1999 Rhmod syndrome: a family study of the translation-initiator mutation in the Rh50 glycoprotein gene.
9746795 1998 Rh-deficiency of the regulator type caused by splicing mutations in the human RH50 gene.
9716608 1998 Rh50 glycoprotein gene and rhnull disease: a silent splice donor is trans to a Gly279-->Glu missense mutation in the conserved transmembrane segment.
9479501 1998 Organization of the human RH50A gene (RHAG) and evolution of base composition of the RH gene family.
9473510 1998 Identification of 5' flanking sequence of RH50 gene and the core region for erythroid-specific expression.
9454778 1998 A novel single missense mutation identified along the RH50 gene in a composite heterozygous Rhnull blood donor of the regulator type.
9442063 1998 The human Rh50 glycoprotein gene. Structural organization and associated splicing defect resulting in Rh(null) disease.
8563755 1996 Candidate gene acting as a suppressor of the RH locus in most cases of Rh-deficiency.
3146980 1988 Protein-sequence studies on Rh-related polypeptides suggest the presence of at least two groups of proteins which associate in the human red-cell membrane.
1417776 1992 Isolation of cDNA clones for a 50 kDa glycoprotein of the human erythrocyte membrane associated with Rh (rhesus) blood-group antigen expression.