Property Summary

NCBI Gene PubMed Count 27
PubMed Score 14.60
PubTator Score 43.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 1.8e-02
posterior fossa group A ependymoma 2.400 5.4e-12
psoriasis -1.100 1.5e-03
osteosarcoma -1.023 1.9e-04
lung adenocarcinoma -1.200 1.2e-16
lung carcinoma -1.300 1.2e-07
non-small cell lung carcinoma -1.100 1.0e-22

 OMIM Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (20)

PMID Text
26345773 To identify single-nucleotide polymorphisms that contribute to the genetic susceptibility to schizophrenia, we examined the potential association between schizophrenia and 9 single nucleotide polymorphisms in the G-protein signaling 9 gene
25591550 These findings indicate a role for RGS9 gene polymorphisms in heroin dependence and may be informative for future genetic or biological studies on heroin dependence.
23857581 the GAP activity of RGS9-2 showed a strong receptor preference for D2R over MOR. Finally, RGS7 displayed an four times greater GAP activity relative to RGS9-2.
22132185 These studies with humans, rats and mice implicate RGS9-2 as a factor in regulating body weight.
22006018 beta-Arrestin2 is required for the inhibition of D3R signaling by RGS9-2.
21511947 Type 5 G protein beta subunit (Gbeta5) controls the interaction of regulator of G protein signaling 9 (RGS9) with membrane anchors
20627871 Observational study of gene-disease association. (HuGE Navigator)
20477943 The expression of RGS9-2 inhibits dopamine-mediated cellular internalization of the dopamine 2 (D2) receptor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374717 The main goal of this review is to illustrate how various functions are fulfilled through the interplay between the intrinsic molecular properties of RGS9 isoforms.
20016399 no association with schizophrenia in an Israeli Jewish population
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19818506 This is the first report describing a nonsense mutation in RGS9.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18548510 In the haplotype analysis, a significant association of the AGG haplotype (rs8077696-rs8070231-rs2292593) of the RGS9 gene was found (permutation P = 0.007)
18548510 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17698770 homozygous mutations in RGS9 gene that encodes the photoreceptor GTPase accelerating protein and its anchor protein, respectively, have been identifird in patients with bradyopsia.
15901556 Observational study of genotype prevalence. (HuGE Navigator)
15474482 under certain conditions, RGS9 and Gbeta5 may possibly function as betagamma dimer
14702087 five unrelated patients with recessive mutations in the genes encoding either RGS9 or R9AP who report difficulty adapting to sudden changes in luminance levels mediated by cones

AA Sequence

MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIVQRLWISSLEA      1 - 70
QNLGNFIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILEEYE     71 - 140
KENYNFLNQKMNYKWDFVIMQAKEQYRAGKERNKADRYALDCQEKAYWLVHRCPPGMDNVLDYGLDRVTN    141 - 210
PNEVKVNQKQTVVAVKKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQF    211 - 280
WDLNAKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKA    281 - 350
EEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKA    351 - 420
IEPQETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHLTVYTGTCMPP    421 - 490
SPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKGECSGSMAPRGPSVTESSEAS    491 - 560
LDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLSPKCPAVSHGRVQPLGDVGQQLPRLKSKRVA    561 - 630
NFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWESL                              631 - 674
//

Text Mined References (29)

PMID Year Title
26345773 2015 Regulators of G-protein signaling 9 genetic variations in Chinese subjects with schizophrenia.
25591550 2015 Evidence for the contribution of genetic variations in regulator of G protein signaling 9 to the genetic susceptibility of heroin dependence.
23857581 2013 Macromolecular composition dictates receptor and G protein selectivity of regulator of G protein signaling (RGS) 7 and 9-2 protein complexes in living cells.
22132185 2011 Association between regulator of G protein signaling 9-2 and body weight.
22006018 2011 ?-arrestin2 plays permissive roles in the inhibitory activities of RGS9-2 on G protein-coupled receptors by maintaining RGS9-2 in the open conformation.
21511947 2011 Type 5 G protein beta subunit (Gbeta5) controls the interaction of regulator of G protein signaling 9 (RGS9) with membrane anchors.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20477943 2010 RGS9-2 mediates specific inhibition of agonist-induced internalization of D2-dopamine receptors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374717 2009 Biology and functions of the RGS9 isoforms.
20016399 2010 No association between regulator of G-protein signaling 9 (RGS9) and schizophrenia in a Jewish population.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19818506 2010 Novel mutations and electrophysiologic findings in RGS9- and R9AP-associated retinal dysfunction (Bradyopsia).
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18548510 2009 Analysis of genetic variations in the RGS9 gene and antipsychotic-induced tardive dyskinesia in schizophrenia.
17698770 2007 Bradyopsia in an Asian man.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15901556 2002 [Analysis of GUCA1B,GNGT1 and RGS9 genes in patients with retinitis pigmentosa].
15474482 2004 Enhancement of pheromone response by RGS9 and Gbeta5 in yeast.
14702087 2004 Defects in RGS9 or its anchor protein R9AP in patients with slow photoreceptor deactivation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614075 2003 The DEP domain determines subcellular targeting of the GTPase activating protein RGS9 in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119397 2002 R9AP, a membrane anchor for the photoreceptor GTPase accelerating protein, RGS9-1.
11485301 2001 Inhibition of retinal guanylyl cyclase by the RGS9-1 N-terminus.
10564809 1999 Structure, alternative splicing, and expression of the human RGS9 gene.
9765512 1998 Molecular characterization of human and rat RGS 9L, a novel splice variant enriched in dopamine target regions, and chromosomal localization of the RGS 9 gene.
9560279 1998 High expression levels in cones of RGS9, the predominant GTPase accelerating protein of rods.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.