Property Summary

Ligand Count 3
NCBI Gene PubMed Count 22
PubMed Score 30.62
PubTator Score 14.44

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 1.4e-03
astrocytic glioma -1.800 6.9e-03
Astrocytoma, Pilocytic -2.800 3.3e-08
atypical teratoid / rhabdoid tumor -2.200 7.5e-04
diabetes mellitus 1.100 1.3e-03
ependymoma -1.900 1.0e-02
facioscapulohumeral dystrophy 2.300 1.0e-02
glioblastoma -2.200 9.5e-07
group 3 medulloblastoma -1.600 3.7e-02
medulloblastoma, large-cell -2.000 2.3e-03
oligodendroglioma -1.800 8.1e-03

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

TCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS                                  141 - 180

Text Mined References (23)

PMID Year Title