Property Summary

NCBI Gene PubMed Count 8
PubMed Score 20.54
PubTator Score 12.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.200 9.2e-03
ependymoma -4.300 1.3e-23
oligodendroglioma -1.700 4.0e-02
glioblastoma -5.000 9.9e-08
medulloblastoma -4.800 2.2e-11
non diabetic and post-ischemic heart fai... 1.100 8.2e-03
atypical teratoid / rhabdoid tumor -5.400 3.6e-20
medulloblastoma, large-cell -5.600 1.8e-08
primitive neuroectodermal tumor -4.200 4.7e-07
adult high grade glioma -4.300 1.6e-06
pilocytic astrocytoma -3.000 1.3e-06
lung carcinoma 1.100 2.7e-03

Gene RIF (5)

PMID Text
26895961 R7-binding protein had a strong inhibitory effect on homo-oligomerization of RGS7.
21457877 BL3-ht2 of RGS7BP may be an important genetic variant associated with AERD. The haplotype of block 3 may play a protective role against aspirin hypersensitivity in asthma, perhaps by altering the responsiveness of muscarinic receptors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19497306 the successful purification of functionally intact Gbeta5-free recombinant RGS11 was reported that differentially interact with R7BP and Galpha(oa).
16867977 cytoplasmic RGS7*Gbeta5*R7BP heterotrimers and RGS7*Gbeta5 heterodimers are equivalently inefficient regulators of G protein-coupled receptor signaling relative to plasma membrane-bound heterotrimers bearing palmitoylated R7BP.

AA Sequence

MSSAPNGRKKRPSRSTRSSIFQISKPPLQSGDWERRGSGSESAHKTQRALDDCKMLVQEFNTQVALYREL      1 - 70
VISIGDVSVSCPSLRAEMHKTRTKGCEMARQAHQKLAAISGPEDGEIHPEICRLYIQLQCCLEMYTTEML     71 - 140
KSICLLGSLQFHRKGKEPGGGTKSLDCKIEESAETPALEDSSSSPVDSQQHSWQVSTDIENTERDMREMK    141 - 210
NLLSKLRETMPLPLKNQDDSSLLNLTPYPLVRRRKRRFFGLCCLISS                           211 - 257
//

Text Mined References (12)

PMID Year Title
26895961 2016 Regulator of G Protein Signaling 7 (RGS7) Can Exist in a Homo-oligomeric Form That Is Regulated by G?o and R7-binding Protein.
21457877 2011 Association analysis of RGS7BP gene polymorphisms with aspirin intolerance in asthmatic patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19497306 2009 RGS11 interacts preferentially with R7BP over Galpha(oa)--characterization of Gbeta5-free RGS11.
19042037 2009 R9AP and R7BP: traffic cops for the RGS7 family in phototransduction and neuronal GPCR signaling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16867977 2006 R7BP augments the function of RGS7*Gbeta5 complexes by a plasma membrane-targeting mechanism.
15632198 2005 R7BP, a novel neuronal protein interacting with RGS proteins of the R7 family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.