Property Summary

NCBI Gene PubMed Count 42
PubMed Score 29.80
PubTator Score 21.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma -1.700 1.1e-09
glioblastoma -1.600 4.9e-04
group 4 medulloblastoma -1.800 2.2e-05
atypical teratoid / rhabdoid tumor -1.400 6.0e-05
medulloblastoma, large-cell -1.900 4.2e-04
primitive neuroectodermal tumor -1.300 6.9e-03
adult high grade glioma -1.800 4.1e-05
pilocytic astrocytoma -1.300 3.7e-04
psoriasis -1.100 9.9e-26

Protein-protein Interaction (2)

Gene RIF (20)

PMID Text
26653562 reduced RGS6 expression is associated with poor survival in colorectal cancer patients, suggesting that RGS6 expression may serve as an important prognostic marker
26340433 No significant association between SNPs of RGS6 and central adiposity has been found.
25525169 we found a novel mutation in RGS6, the splice-acceptor variant c.1369-1G>C that was not previously reported in congenital cataract phenotypes.
25120791 these date demonstrate that RGS6 decreases in tumor tissue and may serve as a novel biomarker for outcomes in pancreatic cancer patients and be a potential therapeutic target potential therapeutic target.
23619123 This suggests that HA117 might be an important resistance gene in pediatric solid tumors.
21233807 genetic association studies in Hispanic-American families in Texas and Colorado: SNP in RGS6 are associated with high dietary fat intake, food preferences, and adiposity/obesity phenotype
21041304 RGS6-induced apoptosis in both breast cancer cells and mouse embryonic fibroblasts does not require its GAP activity toward G proteins
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
16691626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15375002 Observational study of gene-disease association. (HuGE Navigator)
14734556 RGS6 is the first member of the RGS protein family shown to interact with proteins involved in transcriptional regulation.
12761221 RGS6 gene structure, complex alternative splicing, and role of N terminus and G protein gamma-subunit-like (GGL) domain in subcellular localization of RGS6 splice variants
12761220 Role of the RGS domain in stress-induced trafficking of RGS6 protein
12140291 interacts with SCG10 and promotes neuronal differentiation; role of the G gamma subunit-like (GGL) domain of this protein

AA Sequence

MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLM      1 - 70
KNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTM     71 - 140
QNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCV    141 - 210
NTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMS    211 - 280
KVAESLIAYTEQYVEYDPLITPAEPSNPWISDDVALWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQF    281 - 350
LRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY    351 - 420
TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS                      421 - 472
//

Text Mined References (44)

PMID Year Title
26653562 2015 Prognostic value of regulator of G-protein signaling 6 in colorectal cancer.
26340433 2015 A Common Variant of NGEF Is Associated with Abdominal Visceral Fat in Korean Men.
26097584 2015 Differential expression of FOXA1, DUSP6, and HA117 in colon segments of Hirschsprung's disease.
25525169 2014 RGS6: a novel gene associated with congenital cataract, mental retardation, and microcephaly in a Tunisian family.
25120791 2014 Decreased RGS6 expression is associated with poor prognosis in pancreatic cancer patients.
25120773 2014 Expression profiles of HA117 and its neighboring gene DPF3 in different colon segments of Hirschsprung's disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23619123 2014 Expression of the novel all-trans retinoic acid-related resistance gene HA117 in pediatric solid tumors.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22566634 2012 The genetic architecture of economic and political preferences.
21935397 2011 Genome-wide population-based association study of extremely overweight young adults--the GOYA study.
21720420 2011 Screening siRNAs targeting a novel gene (HA117) and the development of a derivative recombinant adenovirus delivery system.
21316428 2011 Construction, screening and evaluation of a derivative recombinant adenovirus for the optimal siRNA targeting of a novel gene (HA117).
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21233807 2011 RGS6 variants are associated with dietary fat intake in Hispanics: the IRAS Family Study.
21041304 2011 Regulator of G protein signaling 6 (RGS6) induces apoptosis via a mitochondrial-dependent pathway not involving its GTPase-activating protein activity.
20811658 Genome-wide association for smoking cessation success in a trial of precessation nicotine replacement.
20642825 2010 Functional study of the novel multidrug resistance gene HA117 and its comparison to multidrug resistance gene 1.
20635168 2011 Multidrug resistance strength of the novel multidrug resistance gene HA117: compared with MRP1.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19435509 2009 HA117 gene increased the multidrug resistance of K562 cells in vitro: an investigation to the function of a novel gene related to drug resistance.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
16691626 2006 A nonsynonymous single-nucleotide polymorphism in the PDZ-Rho guanine nucleotide exchange factor (Ser1416Gly) modulates the risk of lung cancer in Mexican Americans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15375002 2004 A functional polymorphism in RGS6 modulates the risk of bladder cancer.
14734556 2004 RGS6 interacts with DMAP1 and DNMT1 and inhibits DMAP1 transcriptional repressor activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761221 2003 Human RGS6 gene structure, complex alternative splicing, and role of N terminus and G protein gamma-subunit-like (GGL) domain in subcellular localization of RGS6 splice variants.
12761220 2003 Mild heat and proteotoxic stress promote unique subcellular trafficking and nucleolar accumulation of RGS6 and other RGS proteins. Role of the RGS domain in stress-induced trafficking of RGS proteins.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140291 2002 RGS6 interacts with SCG10 and promotes neuronal differentiation. Role of the G gamma subunit-like (GGL) domain of RGS6.
10521509 1999 Regulators of G protein signaling 6 and 7. Purification of complexes with gbeta5 and assessment of their effects on g protein-mediated signaling pathways.
10339615 1999 Fidelity of G protein beta-subunit association by the G protein gamma-subunit-like domains of RGS6, RGS7, and RGS11.
10083744 1999 The human regulator of G-protein signaling protein 6 gene (RGS6) maps between markers WI-5202 and D14S277 on chromosome 14q24.3.
7596406 1995 Cloning of a gene bearing missense mutations in early-onset familial Alzheimer's disease.