Property Summary

NCBI Gene PubMed Count 45
PubMed Score 45.64
PubTator Score 36.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 1.0
Disease Target Count Z-score Confidence
Sick building syndrome 10 3.832 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma 1.200 2.3e-02
osteosarcoma -1.436 1.8e-05
posterior fossa group B ependymoma 1.300 4.8e-11
subependymal giant cell astrocytoma 1.119 8.9e-03
ovarian cancer 2.100 3.5e-06

 GO Function (1)

Gene RIF (18)

PMID Text
26416661 Our data provide a novel miR-25/RGS3 signal in the development of lung cancer.
24375609 cardiac overexpression of RGS3 inhibits maladaptive hypertrophy and fibrosis and improves cardiac function by blocking MEK-ERK1/2 signaling
24297163 ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected.
22859293 PDZ-RGS3 can enhance signals generated by the Wnt canonical pathway and plays a pivotal role in epithelial mesenchymal transition
22027839 Results suggest that the 14-3-3 protein binding affects the structure of the Galpha interaction portion of RGS3 as well as sterically blocks the interaction between the RGS domain and the Galpha subunit of heterotrimeric G proteins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627871 Observational study of gene-disease association. (HuGE Navigator)
20347994 14-3-3 protein binding induces structural changes in both the N-terminal part and the C-terminal RGS domain of phosphorylated RGS3 molecule
19913121 Observational study of gene-disease association. (HuGE Navigator)
19778949 Regulator of G-protein signalling 3 (RGS3) showed a difference between follicular cells from follicles leading to a pregnancy or developmental failure.
19333232 in apoptosis-initiated cells, the ligand-dependent C5aR-mediated dual signal affects the fate of cells, either apoptosis execution or survival, through regulation of RGS3 gene expression and subsequent modulation of ERK signal.
18287247 This study identifies a novel, noncanonical role of RGS3 in regulation of TGF-beta signaling through its interaction with Smads and interfering with Smad heteromerization.
17300916 RGS3L functions as a molecular switch, redirecting Gi-coupled receptors via Gbetagamma-dimers and PI3K from Rac1 to RhoA activation.
16855219 Full-length RGS3, RGS3T, and the core domain of RGS3 were equally effective in antagonizing inhibition of Ca(V)2.3 through M(2)R.
16821082 mRNA expression of CCT5, RGS3, and YKT6 was significantly up-regulated in p53-mutated tumors and associated with a low response rate to docetaxel.
15383626 RFS3 promoted the conversion of more stable Ca2+ elevations into oscillatory signals.
12210723 C2PA is expressed in the cell nucleus and induces heat shock response element (HSE)-dependent gene transcription
11985497 Data are consistent with the model wherein 14-3-3 serves as a scavenger of RGS3, regulating the amounts of RGS3 available for binding G-proteins.

AA Sequence

MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQDSLPFGRRLYS      1 - 70
GPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEWTQTSPARKRITHAKVQGAGQ     71 - 140
LRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQ    141 - 210
EEDDQKRLLVTVWNRASQSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLR    211 - 280
DPLLRMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVE    281 - 350
HWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQ    351 - 420
RHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTI    421 - 490
PEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPL    491 - 560
DLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLK    561 - 630
FCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPG    631 - 700
AEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEP    701 - 770
PPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLL    771 - 840
AATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGER    841 - 910
SEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPS    911 - 980
TLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPA    981 - 1050
GKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAS   1051 - 1120
KAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLIN   1121 - 1190
QKKMSPPL                                                                 1191 - 1198
//

Text Mined References (50)

PMID Year Title
26416661 2016 Elevated microRNA-25 inhibits cell apoptosis in lung cancer by targeting RGS3.
25416956 2014 A proteome-scale map of the human interactome network.
24375609 2014 Regulator of G protein signaling 3 protects against cardiac hypertrophy in mice.
24297163 2014 Regulation of protease-activated receptor 1 signaling by the adaptor protein complex 2 and R4 subfamily of regulator of G protein signaling proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22859293 2012 Regulator of G-protein signaling 3 isoform 1 (PDZ-RGS3) enhances canonical Wnt signaling and promotes epithelial mesenchymal transition.
22699066 2012 [Identification of differentially expressed genes related to blastic crisis in chronic myeloid leukemia].
22027839 2011 Structural basis for the 14-3-3 protein-dependent inhibition of the regulator of G protein signaling 3 (RGS3) function.
21918105 2011 Galphas-biased beta2-adrenergic receptor signaling from restoring synchronous contraction in the failing heart.
21681376 2011 Priming with very low-affinity peptide ligands gives rise to CD8(+) T-cell effectors with enhanced function but with greater susceptibility to transforming growth factor (TGF)?-mediated suppression.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20347994 2010 14-3-3 protein interacts with and affects the structure of RGS domain of regulator of G protein signaling 3 (RGS3).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19778949 2010 Genomic assessment of follicular marker genes as pregnancy predictors for human IVF.
19333232 2009 Pro- and anti-apoptotic dual functions of the C5a receptor: involvement of regulator of G protein signaling 3 and extracellular signal-regulated kinase.
19136943 2009 Transcriptome sequencing to detect gene fusions in cancer.
18287247 2008 Regulation of Smad-mediated gene transcription by RGS3.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17300916 2007 Regulator of G-protein signalling 3 redirects prototypical Gi-coupled receptors from Rac1 to RhoA activation.
16884686 2006 Identification and Herc5-mediated ISGylation of novel target proteins.
16855219 2007 Muscarinic modulation of Cav2.3 (R-type) calcium channels is antagonized by RGS3 and RGS3T.
16821082 2007 Possible involvement of CCT5, RGS3, and YKT6 genes up-regulated in p53-mutated tumors in resistance to docetaxel in human breast cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383626 2004 Single-cell imaging of intracellular Ca2+ and phospholipase C activity reveals that RGS 2, 3, and 4 differentially regulate signaling via the Galphaq/11-linked muscarinic M3 receptor.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12210723 2002 C2PA is a nuclear protein implicated in the heat shock response.
12036301 2002 Additional 5' exons in the RGS3 locus generate multiple mRNA transcripts, one of which accounts for the origin of human PDZ-RGS3.
11985497 2002 RGS3 interacts with 14-3-3 via the N-terminal region distinct from the RGS (regulator of G-protein signalling) domain.
11330340 2001 Evidence for a short form of RGS3 preferentially expressed in the human heart.
11301003 2001 Ephrin-B reverse signaling is mediated by a novel PDZ-RGS protein and selectively inhibits G protein-coupled chemoattraction.
11294858 2001 Regulator of G-protein signaling 3 (RGS3) inhibits Gbeta1gamma 2-induced inositol phosphate production, mitogen-activated protein kinase activation, and Akt activation.
11034339 2000 C2PA, a new protein expressed during mouse spermatogenesis.
10749886 2000 Regulator of G protein signaling RGS3T is localized to the nucleus and induces apoptosis.
9858594 1999 RGS3 inhibits G protein-mediated signaling via translocation to the membrane and binding to Galpha11.
9344672 1997 Genomic organization, 5'-flanking region, and chromosomal localization of the human RGS3 gene.
9182581 1997 A truncated form of RGS3 negatively regulates G protein-coupled receptor stimulation of adenylyl cyclase and phosphoinositide phospholipase C.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8602223 1996 Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.