Property Summary

NCBI Gene PubMed Count 126
PubMed Score 240.84
PubTator Score 168.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Malaria 140 0.0 1.0

Expression

  Differential Expression (29)

Protein-protein Interaction (10)

Gene RIF (112)

PMID Text
25970626 FBXO44-mediated degradation of RGS2 protein uniquely depends on a Cul4B/DDB1 complex.
25849301 The RGS2 (-391, C>G) genetic polymorphism may serve as a biomarker to predict a patient's response to antihypertensive drug therapy
25847876 MIR4717 regulates human RGS2 and contributes to the genetic risk towards anxiety-related traits.
25766235 study found that wild-type Met-Gln-Rgs2 and its mutant, Met-Arg-Rgs2, were destroyed by the Ac/N-end rule pathway, which recognizes N(alpha)-terminally acetylated (Nt-acetylated) proteins
25740197 RGS2 polymorphisms were found to be associated with anxiety disorders and dimensional as well as intermediate phenotypes of anxiety.
25664600 RGS2 localizes to the mitotic spindle in a Nek7-dependent manner, and along with Nek7 contributes to spindle morphology and mitotic spindle pole integrity.
25613138 The gene expression of RGS2 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25509855 The results of this study are consistent previous results and support the hypothesis that polymorphic loci RGS2 gene associated with risk of extrapyramidal symptoms induced by typicalneuroleptics-haloperidol, and are involved in schizophrenia pathway.
25368964 genetic variations and increased inflammatory cytokines can lead to RGS2 repression, which exacerbates AHR and airway remodeling in asthma.
25323766 Epigenetic repression of RGS2 by UHRF1 contributes to bladder cancer progression. UHRF1 inhibits RGS2 expression by increasing the methylation of CpG nucleotides of the RGS2 promoter.
25187114 Data show that regulator of G protein signaling 2 (RGS2) was stabilized by deubiquitinase monocyte chemotactic protein-induced protein 1 (MCPIP1).
24794857 This work highlights the role of RGS2 as a key regulator of LRRK2 activity, function and neuronal toxicity.
24593135 Women carrying the rs4606 CG or GG genotype are at elevated risk for developing hypertension after delivery following a preeclamptic pregnancy.
24562335 ACE and RGS2 genotypes are not associated with the development of hypertension in patients with type 1 diabetes mellitus.
24299002 observations support the concept of a functional activation-dependent p63RhoGEF-Galphaq-RGS2 complex
24297163 ectopic expression of R4 subfamily members RGS2, RGS3, RGS4, and RGS5 reduced activated PAR1 wild-type signaling, whereas signaling by the PAR1 AKKAA mutant was minimally affected.
23859711 This meta-analysis revealed that the RGS2 1891-1892del TC polymorphism and CYP4A11 T8590C polymorphism were associated with hypertension risk.
23587726 RGS2 promoter of hypertensive patients abolished HSF1-regulated expression of RGS2, suggesting that activated HSF1 is involved in blood pressure regulation via modulation of RGS2 expression
23464602 RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies
23349832 Data show that miR-22 specifically interacts with the 3' UTRs of the Rcor1, Rgs2 and HDAC4 mRNAs.
23339167 It was shown that the RGS2 rs4606 single nucleotide polymorphism may affect the risk and progression of preeclampsia.
23277133 The study was unable to replicate or extend prior association findings between RGS2 variants and various anxiety-related phenotypes using a large, independent sample.
22704538 Loss of RGS2 also increased ASM mass and stimulated airway smooth muscle cell growth via extracellular signal-regulated kinase and phosphatidylinositol 3-kinase pathways
22695717 In vivo treatment with digoxin led to increased RGS2 protein levels in heart and kidney.
22080612 Data identify RGS2 gene expression as a genomic mechanism of bronchoprotection that is induced by glucocorticoids plus beta(2)-adrenoceptor agonist (LABA) in airway smooth muscle.
22057271 Identification of a cAMP-response element in the regulator of G-protein signaling-2 (RGS2) promoter as a key cis-regulatory element for RGS2
21779398 Findings both identify RGS2 downregulation as a novel compensatory response in HD neurons and suggest that RGS2 inhibition might be considered as an innovative target for neuroprotective drug development.
21529451 The variants and their frequencies in RGS2 gene in Kazakh hypertensives may have ethnic differences when compared with other populations.
21500190 Reduced RGS2 protein expression in human prostate cancer specimens.
21451528 genetic polymorphisms in RGS2 are associated with intima-media thickening of carotid artery in humans.
21438143 The haplotypes T-G-C and T-C-T showed significant association and protective effect on Panic disorder; results provide support for an association of RGS2 with panic disorder in a Japanese population
21291998 The essential roles of both N-terminal subdomains for the potent inhibitory activity of RGS2 on AT1 receptor signaling.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20981351 Observational study of gene-disease association. (HuGE Navigator)
20847599 These findings suggest that RGS2 may not be genetically involved in the biological susceptibility to panic disorder in Japanese.
20847599 Observational study of gene-disease association. (HuGE Navigator)
20662725 The D allele of 1891-1892 TC insertion/deletion of RGS2 might be an independent risk factor for hypertension in Xinjiang Kazakhs.
20662725 Observational study of gene-disease association. (HuGE Navigator)
20633139 data suggest that RGS2 and RGS8 differentially associate with MCHR1 and may represent two distinct modes of signaling mechanisms in vivo
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627871 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20403096 platelet Gs signaling defect caused by a heterozygous RGS2 variant that results in a unique mutational mechanism, such as the differential use of translation initiation sites resulting in different functional RGS2 isoforms.
20375904 Reduced RGS2 expression contributes to resistance to antihypertensive agents through poor negative feedback on the effects of aldosterone and of other vasoactive agents.
20140863 The D allele of the 1891-1892TC insertion/deletion locus of the RGS2 gene is an independent risk factor for hypertension in a Chinese population.
20032508 Ischemic stress increases RGS2 expression and that this condition contributes to enhanced apoptosis in C6 cells and primary astrocytes.
20001967 down-regulation of RGS2 might play an important role in colorectal cancer (CRC) metastasis and predict poor prognosis in stage II and III CRC patients.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19931593 rs4606 does not affect AIEPSs in Japanese subjects.
19931593 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19813112 RGS2 rs4606 is related to risk of current suicidal ideation in stressor-exposed adults.
19813112 Observational study of gene-disease association. (HuGE Navigator)
19778949 Phosphoglycerate kinase 2 (PGK2) showed a difference between follicular cells from follicles leading to a pregnancy or developmental failure.
19626040 Observational study of gene-disease association. (HuGE Navigator)
19478087 Study determined a model of the triple mutant RGS2 in complex with a transition state mimetic form of Galpha(i) at 2.8-A resolution.
19427970 Results suggest the association of G/G 1114 RGS2 genotype with the number of episodes of neurally mediated syncope. Molecular mechanism of the influence of the polymorphism on syncopal number is associated with the reduced expression of RGS2 gene.
19427970 Observational study of gene-disease association. (HuGE Navigator)
19243996 Observational study of gene-disease association. (HuGE Navigator)
19175184 RGS2 expression was upregulated by LH receptor and FP receptor activation and modulation of partner receptor signaling by RGS2 may require RGS2 translocation from the nucleus to the plasma membrane.
19162436 Varian in RGS2 moderates posttraumatic stress symptoms following a traumatic event exposure.
19162436 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156702 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19155782 Observational study of gene-disease association. (HuGE Navigator)
19064631 Regulators of G protein signaling-2 (RGS2) can interact with G-protein coupled receptors to modulate their signaling and provide a molecular basis for RGS2 recognition by cholecystokinin-2 receptor.
19023274 RGS2 function contributes to blood pressure regulation; a reduced expression is associated with HT and an increased expression with low blood pressure.
19023274 Observational study of gene-disease association. (HuGE Navigator)
18833580 RGS2 gene is prevalent in generalized anxiety disorder.
18833580 Observational study of gene-disease association. (HuGE Navigator)
18663369 Observational study of gene-disease association. (HuGE Navigator)
18496125 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18398336 Silencing RGS-2 in Bartters syndrome/Gitelman's syndrome patients increased Ang II-induced Cai2+ release and signaling in silenced cells compared with not silenced cells
18360038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18347610 Further evidence for association of the RGS2 gene with antipsychotic-induced parkinsonism: protective role of a functional polymorphism in the 3'-untranslated region.
18347610 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18316676 Observational study of gene-disease association. (HuGE Navigator)
18262772 RGS2 genotypes predicted severity of baseline symptoms in schizophrenia. These data suggest a possible role for multiple RGS proteins in schizophrenia.
18262772 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18249218 the RGS2 1114G allele may be considered a genetic marker that predicts an individual's predisposition to gaining weight
18230714 These data are consistent with the notion that a R44H missense mutation in human RGS2 produces a hypomorphic allele that may lead to altered receptor-mediated G(q) inhibition and contribute to the development of hypertension in affected subjects.
18067675 Functional analysis proved RGS2 to be a modulator of oxytocin receptor signalling. It was also over-expressed in most breast cancers, identifying the product of this gene, or the pathway(s) it regulates, as potentially significant therapeutic targets.
17901199 alternative translation initiation of RGS2 is part of a novel negative feedback control pathway for adenylyl cyclase signaling
17728697 These findings suggest that RGS2 is genetically involved in the biological susceptibility to suicide in the Japanese population.
17728697 Observational study of gene-disease association. (HuGE Navigator)
17558307 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558307 Five out of six single nucleotide polymorphisms within or flanking the RGS2 gene were nominally associated with development or worsening of parkinsonian symptoms induced by treatment with antipsychotic medication.
17294519 Results indicate that cAMP stimulates RGS2 expression, which in turn leads to a decrease in the cAMP production by inactivating the G-protein signaling in the mechanically stressed periodontal ligament cells.
17244887 RGS2 is a key point of integration for multiple intracellular signaling pathways, and they highlight the role of RGS proteins as dynamic, multifunctional signaling centers that coordinate a diverse range of cellular functions.
17220356 examined function, receptor specificity, and expression of R4 subfamily RGS proteins, RGS2, -3, -4, -5, and -8 via missense mutations introduced
17143182 Observational study of gene-disease association. (HuGE Navigator)
16895908 Acts as a novel binding partner and inhibitor of calcium channel TRPV6 and has a putative role in active Ca2+ absorption.
16736243 Observational study of gene-disease association. (HuGE Navigator)
16736243 variations of the Rgs2 gene play a role also for the development of anxiety in humans
16691626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16685212 Low expression of RGS2 contributes to increased G-protein-coupled signaling in hypertensive patients. The allele 1114G is associated with low RGS2 expression and blood pressure increase in humans.
16627589 RGS2 alterations in expression levels or functionality could be implicated in deregulations of Ang II signaling and abnormal aldosterone secretion by the adrenal gland
16449965 our results suggest RGS2 as a novel regulator of androgen receptor signaling and its repression may be an important step during prostate tumorigenesis and progression.
16432041 Observational study of gene-disease association. (HuGE Navigator)
16432041 RGS2 is genetically conserved within coding regions, but intronic in/del define ethnicity-specific haplotypes. Certain RGS2 variants that occur at greater frequency in hypertensive blacks may serve as ethnicity-specific genetic variants for this disease.
16003176 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16003176 Genetic variations of RGS2 were studied in hypertensive patients and in the general population.
15917235 The N terminus of RGS2 was required for association with alpha1A-ARs and inhibition of signaling, and amino acids Lys219, Ser220, and Arg238 within the alpha1A-AR i3 loop were found to be essential for this interaction
15793568 The RGS2 accelerates the GTPase activity of Galpha subunits and act in a G-protein-coupled receptor (GPCR)-specific manner..
15536149 RGS2 is a novel mediator of myeloid differentiation, and its repression is an important event in Flt3-ITD-induced transformation
15383626 RGS2 promoted the conversion of more stable Ca2+ elevations into oscillatory signals.
15375002 Observational study of gene-disease association. (HuGE Navigator)
15362969 TSH-dependent RGS 2 mRNA expression and the suppression of TSH-G(q)alpha signaling by the overexpression of RGS 2 imply that RGS 2 is involved in TSHR-induced G(q) signal transduction.
15292363 RGS-2 level in human clinical condition characterized by altered vascular tone. Importance of RGS-2 as key regulator element for Ang II signaling. Links between Bartter's/Gitelman's syndrome genetic abnormalities and abnormal vascular tone regulation.
12604604 Identification of RGS2 and type V adenylyl cyclase interaction sites.
12356577 RGS2 plays a role in regulating purinergic signaling in human broncheotracheal cells

AA Sequence

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI      1 - 70
KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI     71 - 140
EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA    141 - 210
T//

Text Mined References (129)

PMID Year Title
25970626 2015 FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex.
25849301 2015 The RGS2 (-391, C>G) genetic variation correlates to antihypertensive drug responses in Chinese patients with essential hypertension.
25847876 2015 MicroRNA hsa-miR-4717-5p regulates RGS2 and may be a risk factor for anxiety-related traits.
25766235 2015 Control of mammalian G protein signaling by N-terminal acetylation and the N-end rule pathway.
25740197 2015 RGS2 ggenetic variation: association analysis with panic disorder and dimensional as well as intermediate phenotypes of anxiety.
25664600 2015 Human Nek7-interactor RGS2 is required for mitotic spindle organization.
25509855 [Polymorphism of RGS2 gene: genetic markers of risk for schizophrenia and pharmacogenetic markers of typical neuroleptics efficiency].
25416956 2014 A proteome-scale map of the human interactome network.
25368964 2015 Regulator of G-protein signaling 2 repression exacerbates airway hyper-responsiveness and remodeling in asthma.
25323766 2015 Epigenetic repression of regulator of G-protein signaling 2 by ubiquitin-like with PHD and ring-finger domain 1 promotes bladder cancer progression.
25187114 2015 RGS2 suppresses breast cancer cell growth via a MCPIP1-dependent pathway.
24794857 2014 A Parkinson's disease gene regulatory network identifies the signaling protein RGS2 as a modulator of LRRK2 activity and neuronal toxicity.
24593135 2014 Hypertension after preeclampsia and relation to the C1114G polymorphism (rs4606) in RGS2: data from the Norwegian HUNT2 study.
24562335 2014 Non-dipping and arterial hypertension depend on clinical factors rather than on genetic variability of ACE and RGS2 genes in patients with type 1 diabetes.
24299002 2014 Dynamics of G?q-protein-p63RhoGEF interaction and its regulation by RGS2.
24297163 2014 Regulation of protease-activated receptor 1 signaling by the adaptor protein complex 2 and R4 subfamily of regulator of G protein signaling proteins.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23859711 2013 Genetic associations with hypertension: meta-analyses of six candidate genetic variants.
23587726 2013 Stress-induced transcription of regulator of G protein signaling 2 (RGS2) by heat shock transcription factor HSF1.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23349832 2013 MicroRNA-22 (miR-22) overexpression is neuroprotective via general anti-apoptotic effects and may also target specific Huntington's disease-related mechanisms.
23339167 2013 Single nucleotide polymorphisms in G protein signaling pathway genes in preeclampsia.
23277133 2013 Genetic association study between RGS2 and anxiety-related phenotypes.
22704538 2012 Regulator of G protein signaling 2 is a key modulator of airway hyperresponsiveness.
22695717 2012 Cardiotonic steroids stabilize regulator of G protein signaling 2 protein levels.
22080612 2011 ?2-Adrenoceptor agonist-induced RGS2 expression is a genomic mechanism of bronchoprotection that is enhanced by glucocorticoids.
22057271 2011 Identification of a cAMP-response element in the regulator of G-protein signaling-2 (RGS2) promoter as a key cis-regulatory element for RGS2 transcriptional regulation by angiotensin II in cultured vascular smooth muscles.
21779398 2011 Decreased striatal RGS2 expression is neuroprotective in Huntington's disease (HD) and exemplifies a compensatory aspect of HD-induced gene regulation.
21529451 2011 Detection of genetic variations of regulator of G-protein signaling 2 in hypertensives by sequencing.
21500190 2012 Epigenetic repression of regulator of G-protein signaling 2 promotes androgen-independent prostate cancer cell growth.
21451528 2011 Association of intima-media thickening of carotid artery with genetic polymorphisms of the regulator of G-protein signaling 2 gene in patients with hypertension and in the general population.
21438143 2011 Association of RGS2 variants with panic disorder in a Japanese population.
21291998 2011 Potent and selective inhibition of angiotensin AT1 receptor signaling by RGS2: roles of its N-terminal domain.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20981351 2010 Promoter Polymorphism of RGS2 Gene Is Associated with Change of Blood Pressure in Subjects with Antihypertensive Treatment: The Azelnidipine and Temocapril in Hypertensive Patients with Type 2 Diabetes Study.
20847599 2010 Association study of RGS2 gene polymorphisms with panic disorder in Japanese.
20662725 2010 Association of genetic variations of regulator of G-protein signaling 2 with hypertension in the general Xinjiang Kazakh population.
20633139 2010 Functional interaction of regulator of G protein signaling-2 with melanin-concentrating hormone receptor 1.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20403096 2010 Platelet Gs hypofunction and abnormal morphology resulting from a heterozygous RGS2 mutation.
20375904 2010 RGS2 expression and aldosterone: renin ratio modulate response to drug therapy in hypertensive patients.
20140863 2010 [Association between the regulator of G-protein signaling 2 gene 1891-1892del TC polymorphism with hypertension in Xinjiang Kazakh population].
20032508 2010 Ischemia induces regulator of G protein signaling 2 (RGS2) protein upregulation and enhances apoptosis in astrocytes.
20001967 2010 Analysis of RGS2 expression and prognostic significance in stage II and III colorectal cancer.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19931593 2010 Association analysis between functional polymorphism of the rs4606 SNP in the RGS2 gene and antipsychotic-induced Parkinsonism in Japanese patients with schizophrenia: results from the Juntendo University Schizophrenia Projects (JUSP).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19813112 2009 Variation in RGS2 is associated with suicidal ideation in an epidemiological study of adults exposed to the 2004 Florida hurricanes.
19778949 2010 Genomic assessment of follicular marker genes as pregnancy predictors for human IVF.
19736320 2009 Translational control by RGS2.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
19478087 2009 Structural determinants of G-protein alpha subunit selectivity by regulator of G-protein signaling 2 (RGS2).
19427970 2009 Polymorphism C1114G of gene encoding the cardiac regulator of G-protein signaling 2 may be associated with number of episodes of neurally mediated syncope.
19243996 2009 Genetic insight into syncopal tilted population with severe clinical presentation.
19175184 2008 Regulation of LH receptor and PGF2alpha receptor signaling by the regulator of G protein signaling 2 (RGS2) in human and mouse granulosa cells.
19162436 2009 Variant in RGS2 moderates posttraumatic stress symptoms following potentially traumatic event exposure.
19156702 2009 Lack of association between antipsychotic-induced Parkinsonism or its subsymptoms and rs4606 SNP of RGS2 gene in African-Caribbeans and the possible role of the medication: the Curacao extrapyramidal syndromes study X.
19155782 2009 The environmental and genetic evidence for the association of hyperlipidemia and hypertension.
19064631 2009 Evidence for a direct and functional interaction between the regulators of G protein signaling-2 and phosphorylated C terminus of cholecystokinin-2 receptor.
19023274 2009 Are RGS2 gene polymorphisms associated with high blood pressure in an ethnicity- and gender-specific manner?
18833580 2009 RGS2 and generalized anxiety disorder in an epidemiologic sample of hurricane-exposed adults.
18663369 2010 Panic disorder is associated with the serotonin transporter gene (SLC6A4) but not the promoter region (5-HTTLPR).
18496125 2008 Interactions among genetic variants from contractile pathway of vascular smooth muscle cell in essential hypertension susceptibility of Chinese Han population.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18398336 2008 Silencing regulator of G protein signaling-2 (RGS-2) increases angiotensin II signaling: insights into hypertension from findings in Bartter's/Gitelman's syndromes.
18360038 2008 Identification of hypertension-susceptibility genes and pathways by a systemic multiple candidate gene approach: the millennium genome project for hypertension.
18347610 2009 Further evidence for association of the RGS2 gene with antipsychotic-induced parkinsonism: protective role of a functional polymorphism in the 3'-untranslated region.
18316676 2008 Influence of RGS2 on anxiety-related temperament, personality, and brain function.
18262772 2008 Association of RGS2 and RGS5 variants with schizophrenia symptom severity.
18249218 2008 RGS2 C1114G polymorphism and body weight gain in hypertensive patients.
18230714 2008 The RGS2 gene product from a candidate hypertension allele shows decreased plasma membrane association and inhibition of Gq.
18067675 2007 Regulator of G-protein signalling 2 mRNA is differentially expressed in mammary epithelial subpopulations and over-expressed in the majority of breast cancers.
17901199 2008 Alternative translation initiation of human regulators of G-protein signaling-2 yields a set of functionally distinct proteins.
17728697 2008 Association of RGS2 gene polymorphisms with suicide and increased RGS2 immunoreactivity in the postmortem brain of suicide victims.
17558307 2007 Association of the RGS2 gene with extrapyramidal symptoms induced by treatment with antipsychotic medication.
17464283 2007 Spinophilin/neurabin reciprocally regulate signaling intensity by G protein-coupled receptors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17294519 Role of regulator of G-protein signaling 2 (RGS2) in periodontal ligament cells under mechanical stress.
17244887 2007 RGS proteins: Swiss army knives in seven-transmembrane domain receptor signaling networks.
17220356 2007 N-terminal residues control proteasomal degradation of RGS2, RGS4, and RGS5 in human embryonic kidney 293 cells.
17143182 2007 -391 C to G substitution in the regulator of G-protein signalling-2 promoter increases susceptibility to the metabolic syndrome in white European men: consistency between molecular and epidemiological studies.
16895908 2006 RGS2 inhibits the epithelial Ca2+ channel TRPV6.
16736243 2006 Rgs 2 gene polymorphisms as modulators of anxiety in humans?
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16691626 2006 A nonsynonymous single-nucleotide polymorphism in the PDZ-Rho guanine nucleotide exchange factor (Ser1416Gly) modulates the risk of lung cancer in Mexican Americans.
16685212 2006 Reduced expression of regulator of G-protein signaling 2 (RGS2) in hypertensive patients increases calcium mobilization and ERK1/2 phosphorylation induced by angiotensin II.
16627589 2006 RGS2 is regulated by angiotensin II and functions as a negative feedback of aldosterone production in H295R human adrenocortical cells.
16449965 2006 Regulator of G-protein signaling 2 (RGS2) inhibits androgen-independent activation of androgen receptor in prostate cancer cells.
16432041 2006 Polymorphisms and haplotypes of the regulator of G protein signaling-2 gene in normotensives and hypertensives.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16003176 2005 Genetic variations of regulator of G-protein signaling 2 in hypertensive patients and in the general population.
15917235 2005 Selective inhibition of alpha1A-adrenergic receptor signaling by RGS2 association with the receptor third intracellular loop.
15793568 2005 Spinophilin regulates Ca2+ signalling by binding the N-terminal domain of RGS2 and the third intracellular loop of G-protein-coupled receptors.
15609325 2005 Identification and validation of novel ERBB2 (HER2, NEU) targets including genes involved in angiogenesis.
15536149 2005 RGS2 is an important target gene of Flt3-ITD mutations in AML and functions in myeloid differentiation and leukemic transformation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383626 2004 Single-cell imaging of intracellular Ca2+ and phospholipase C activity reveals that RGS 2, 3, and 4 differentially regulate signaling via the Galphaq/11-linked muscarinic M3 receptor.
15375002 2004 A functional polymorphism in RGS6 modulates the risk of bladder cancer.
15362969 2004 RGS 2 expression is regulated by TSH and inhibits TSH receptor signaling.
15292363 2004 Increased expression of regulator of G protein signaling-2 (RGS-2) in Bartter's/Gitelman's syndrome. A role in the control of vascular tone and implication for hypertension.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14608379 2003 Regulator of G-protein signaling-2 mediates vascular smooth muscle relaxation and blood pressure.
12885252 2003 Differential interaction of GRK2 with members of the G alpha q family.
12604604 2003 Identification of RGS2 and type V adenylyl cyclase interaction sites.
12564955 2003 The aorta and heart differentially express RGS (regulators of G-protein signalling) proteins that selectively regulate sphingosine 1-phosphate, angiotensin II and endothelin-1 signalling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356577 2002 Regulator of G-protein signaling protein 2 modulates purinergic calcium and ciliary beat frequency responses in airway epithelia.
12176127 2002 Expression of ten RGS proteins in human myocardium: functional characterization of an upregulation of RGS4 in heart failure.
11330340 2001 Evidence for a short form of RGS3 preferentially expressed in the human heart.
11278586 2001 Mechanisms governing subcellular localization and function of human RGS2.
11063746 2001 Protein kinase C phosphorylates RGS2 and modulates its capacity for negative regulation of Galpha 11 signaling.
10982407 2000 RGS4 and RGS2 bind coatomer and inhibit COPI association with Golgi membranes and intracellular transport.
10791963 2000 Cytoplasmic, nuclear, and golgi localization of RGS proteins. Evidence for N-terminal and RGS domain sequences as intracellular targeting motifs.
10760272 2000 MIR16, a putative membrane glycerophosphodiester phosphodiesterase, interacts with RGS16.
10747990 2000 Ca2+/Calmodulin reverses phosphatidylinositol 3,4, 5-trisphosphate-dependent inhibition of regulators of G protein-signaling GTPase-activating protein activity.
10072511 1999 Regulators of G protein signaling exhibit distinct patterns of gene expression and target G protein specificity in human lymphocytes.
9794454 1998 Role of regulator of G protein signaling in desensitization of the glucose-dependent insulinotropic peptide receptor.
9405622 1997 RGS2/G0S8 is a selective inhibitor of Gqalpha function.
9174164 1997 Comparison of mRNA expression of two regulators of G-protein signaling, RGS1/BL34/1R20 and RGS2/G0S8, in cultured human blood mononuclear cells.
8673468 1996 A new family of regulators of G-protein-coupled receptors?
8602223 1996 Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family.
8179820 1994 A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells.
7643615 1995 Differential expression of a basic helix-loop-helix phosphoprotein gene, G0S8, in acute leukemia and localization to human chromosome 1q31.
1702972 1990 A set of human putative lymphocyte G0/G1 switch genes includes genes homologous to rodent cytokine and zinc finger protein-encoding genes.