Property Summary

Ligand Count 1
NCBI Gene PubMed Count 31
PubMed Score 50.39
PubTator Score 27.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.500 3.7e-03
glioblastoma 1.800 2.4e-04
invasive ductal carcinoma 1.008 8.1e-05
malignant mesothelioma 1.400 1.4e-06
non primary Sjogren syndrome sicca 1.100 2.5e-02
osteosarcoma -1.302 7.2e-04
tuberculosis 1.200 4.3e-06
ulcerative colitis 1.100 7.0e-03

Gene RIF (10)

AA Sequence

MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL      1 - 70
PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR     71 - 140
LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP    141 - 210
SQSSSEA                                                                   211 - 217
//

Text Mined References (35)

PMID Year Title