Property Summary

NCBI Gene PubMed Count 31
PubMed Score 48.84
PubTator Score 27.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 1.4e-06
osteosarcoma -1.302 7.2e-04
astrocytoma 1.500 3.7e-03
glioblastoma 1.800 2.4e-04
tuberculosis 1.200 4.3e-06
non primary Sjogren syndrome sicca 1.100 2.5e-02
invasive ductal carcinoma 1.008 8.1e-05
ulcerative colitis 1.100 7.0e-03

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1884 confirmatory 54 / 0 / 131 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao.
2311 confirmatory 16 / 0 / 11 Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS19-Galphao for SAR Compounds

Gene RIF (10)

PMID Text
26116529 RGS19 senses cellular iron availability and is stabilized under iron-depleted conditions, resulting in the induction of a growth-inhibitory signal.
24793302 RGS19 may play an important role in controlling the degree of synergism between FGF-1 receptors and 5-HT1A receptors, that may work together to mediate an anti-depressant effect.
23799031 Overall methylation levels in the promoter regions of three genes (ALDH1A1, OPRL1 and RGS19) are elevated in subjects who were exposed to childhood adversity.
23416464 The RGS19 inhibits Ras signaling through a complex network involving a scaffold protein KSR1 and a nucleoside diphosphate kinase Nm23.
22045062 elevated expression of RGS19 can severely disrupt the regulation of mitogen-activated protein kinases by small GTPases
21705135 cyclin D1/3 and Cdk6 were upregulated in HEK293 cells overexpressing RGS19, while INK4A and INK4B were reduced
20468064 Observational study of gene-disease association. (HuGE Navigator)
18360038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15356268 GIPC recruits GAIP (RGS19) to attenuate dopamine D2 receptor signaling
12507475 gene structure and transcription regulation

AA Sequence

MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL      1 - 70
PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR     71 - 140
LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP    141 - 210
SQSSSEA                                                                   211 - 217
//

Text Mined References (35)

PMID Year Title
26116529 2015 RGS19 converts iron deprivation stress into a growth-inhibitory signal.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24793302 2014 5-HT1A receptor-mediated phosphorylation of extracellular signal-regulated kinases (ERK1/2) is modulated by regulator of G protein signaling protein 19.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23799031 2013 Profiling of childhood adversity-associated DNA methylation changes in alcoholic patients and healthy controls.
23416464 2013 RGS19 inhibits Ras signaling through Nm23H1/2-mediated phosphorylation of the kinase suppressor of Ras.
22045062 2012 Elevated expression of RGS19 impairs the responsiveness of stress-activated protein kinases to serum.
21705135 2011 RGS19 stimulates cell proliferation by deregulating cell cycle control and enhancing Akt signaling.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18360038 2008 Identification of hypertension-susceptibility genes and pathways by a systemic multiple candidate gene approach: the millennium genome project for hypertension.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356268 2004 GIPC recruits GAIP (RGS19) to attenuate dopamine D2 receptor signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12826607 2003 Promotion of G alpha i3 subunit down-regulation by GIPN, a putative E3 ubiquitin ligase that interacts with RGS-GAIP.
12507475 2003 Gene structure, dual-promoters and mRNA alternative splicing of the human and mouse regulator of G protein signaling GAIP/RGS19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956658 2002 Expression of human GIPC1 in normal tissues, cancer cell lines, and primary tumors.
11829488 2002 Evolution of the regulators of G-protein signaling multigene family in mouse and human.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11251075 2001 GIPC and GAIP form a complex with TrkA: a putative link between G protein and receptor tyrosine kinase pathways.
11090272 2000 A core-promoter region functions bi-directionally for human opioid-receptor-like gene ORL1 and its 5'-adjacent gene GAIP.
10993892 2000 Erk1/2-dependent phosphorylation of Galpha-interacting protein stimulates its GTPase accelerating activity and autophagy in human colon cancer cells.
10760275 2000 Membrane-associated GAIP is a phosphoprotein and can be phosphorylated by clathrin-coated vesicles.
10760272 2000 MIR16, a putative membrane glycerophosphodiester phosphodiesterase, interacts with RGS16.
10452897 1999 Solution structure of human GAIP (Galpha interacting protein): a regulator of G protein signaling.
10364213 1999 Structural basis for the selectivity of the RGS protein, GAIP, for Galphai family members. Identification of a single amino acid determinant for selective interaction of Galphai subunits with GAIP.
10359779 1999 Clathrin-coated vesicles bearing GAIP possess GTPase-activating protein activity in vitro.
9770488 1998 GIPC, a PDZ domain containing protein, interacts specifically with the C terminus of RGS-GAIP.
9748280 1998 RGSZ1, a Gz-selective RGS protein in brain. Structure, membrane association, regulation by Galphaz phosphorylation, and relationship to a Gz gtpase-activating protein subfamily.
9571244 1998 RGS-GAIP, a GTPase-activating protein for Galphai heterotrimeric G proteins, is located on clathrin-coated vesicles.
9305927 1997 Control of the expression and activity of the Galpha-interacting protein (GAIP) in human intestinal cells.
8986788 1996 GAIP is membrane-anchored by palmitoylation and interacts with the activated (GTP-bound) form of G alpha i subunits.
8524874 1995 GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain.